Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094F910

Protein Details
Accession A0A094F910    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-36TAGPCLRCKVLKKKCDCQNPCKECPQQDHydrophilic
507-530PGAAGDKRPKRRELSKEQREHAAABasic
NLS Segment(s)
PositionSequence
512-520DKRPKRREL
Subcellular Location(s) mito 13, nucl 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
CDD cd00067  GAL4  
Amino Acid Sequences GVGAGGVRTAGPCLRCKVLKKKCDCQNPCKECPQQDMMAPDLWKALGCFHGPLTEMVRKCLHGFESPSSRPATGTPTSEIFWAAELDYLMNNHPGFVSLSDSFWDSRHKLALNSADIMDTTPDLTDVAYKRLLLQYGPAVGLLKTAALDRAYLGKTAYNPFALLRVGKEAMEACHDPSSWHLYTLSHTLLLTAIRYRLALSTSTTPPPLTAPLTAFLLAFDTRFTNRKELPPSAWLAAFHSLCLFSITKTLLIDTPSPHQSSPHDAAARLATAHKILVSVFAWSAKLSAWCPKEPLELRDPLLRDWTRDANPNVSPPIRDALVATQGLVNRDGWAKSCIRHTKDFLLGLGAGNVEGGFNGFLAMRYGGAEAGYRGGDGFAPPAQRRRTDSGVATENLPPVKSPLAEDAPVSTSSTPAARRAPLPHYPPPAASAAWRVASPASEGEGERAASYYHRRPLAVGGASSEGAGFGVSSSSGGVAVAARMPLPSVAARVGSVEENRGAAGSPGAAGDKRPKRRELSKEQREHAAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.36
3 0.44
4 0.54
5 0.6
6 0.67
7 0.72
8 0.77
9 0.8
10 0.86
11 0.86
12 0.86
13 0.87
14 0.86
15 0.84
16 0.83
17 0.81
18 0.75
19 0.73
20 0.68
21 0.6
22 0.55
23 0.52
24 0.45
25 0.42
26 0.36
27 0.29
28 0.25
29 0.21
30 0.18
31 0.15
32 0.14
33 0.13
34 0.14
35 0.15
36 0.14
37 0.16
38 0.17
39 0.19
40 0.23
41 0.27
42 0.26
43 0.29
44 0.3
45 0.3
46 0.3
47 0.32
48 0.29
49 0.27
50 0.31
51 0.34
52 0.41
53 0.41
54 0.43
55 0.42
56 0.39
57 0.34
58 0.31
59 0.3
60 0.25
61 0.26
62 0.26
63 0.26
64 0.26
65 0.26
66 0.25
67 0.19
68 0.16
69 0.13
70 0.1
71 0.09
72 0.09
73 0.09
74 0.09
75 0.09
76 0.1
77 0.13
78 0.13
79 0.12
80 0.12
81 0.12
82 0.13
83 0.12
84 0.16
85 0.13
86 0.14
87 0.14
88 0.16
89 0.15
90 0.16
91 0.21
92 0.18
93 0.19
94 0.23
95 0.24
96 0.23
97 0.28
98 0.33
99 0.3
100 0.3
101 0.28
102 0.24
103 0.22
104 0.21
105 0.16
106 0.1
107 0.08
108 0.06
109 0.06
110 0.06
111 0.06
112 0.1
113 0.11
114 0.14
115 0.14
116 0.14
117 0.16
118 0.18
119 0.19
120 0.14
121 0.16
122 0.15
123 0.16
124 0.16
125 0.14
126 0.13
127 0.12
128 0.12
129 0.09
130 0.07
131 0.06
132 0.06
133 0.07
134 0.07
135 0.07
136 0.07
137 0.12
138 0.12
139 0.13
140 0.13
141 0.13
142 0.15
143 0.18
144 0.19
145 0.15
146 0.15
147 0.15
148 0.16
149 0.15
150 0.13
151 0.11
152 0.13
153 0.13
154 0.12
155 0.13
156 0.13
157 0.12
158 0.16
159 0.15
160 0.14
161 0.15
162 0.15
163 0.14
164 0.15
165 0.22
166 0.17
167 0.18
168 0.17
169 0.16
170 0.18
171 0.21
172 0.19
173 0.13
174 0.12
175 0.11
176 0.11
177 0.11
178 0.1
179 0.08
180 0.08
181 0.08
182 0.08
183 0.08
184 0.08
185 0.09
186 0.09
187 0.11
188 0.15
189 0.17
190 0.19
191 0.19
192 0.18
193 0.17
194 0.17
195 0.17
196 0.14
197 0.12
198 0.12
199 0.12
200 0.13
201 0.13
202 0.12
203 0.09
204 0.1
205 0.09
206 0.08
207 0.07
208 0.08
209 0.09
210 0.13
211 0.15
212 0.18
213 0.21
214 0.27
215 0.31
216 0.33
217 0.34
218 0.33
219 0.33
220 0.29
221 0.27
222 0.22
223 0.18
224 0.19
225 0.17
226 0.14
227 0.12
228 0.11
229 0.1
230 0.12
231 0.1
232 0.06
233 0.09
234 0.09
235 0.09
236 0.09
237 0.1
238 0.09
239 0.1
240 0.11
241 0.11
242 0.14
243 0.16
244 0.17
245 0.16
246 0.16
247 0.16
248 0.21
249 0.23
250 0.24
251 0.22
252 0.21
253 0.22
254 0.21
255 0.2
256 0.14
257 0.11
258 0.07
259 0.07
260 0.07
261 0.06
262 0.06
263 0.05
264 0.07
265 0.06
266 0.07
267 0.06
268 0.07
269 0.07
270 0.07
271 0.07
272 0.06
273 0.07
274 0.07
275 0.14
276 0.17
277 0.17
278 0.19
279 0.19
280 0.26
281 0.27
282 0.3
283 0.27
284 0.27
285 0.28
286 0.3
287 0.3
288 0.24
289 0.29
290 0.26
291 0.23
292 0.24
293 0.27
294 0.25
295 0.3
296 0.31
297 0.27
298 0.28
299 0.29
300 0.29
301 0.25
302 0.23
303 0.18
304 0.19
305 0.15
306 0.14
307 0.13
308 0.11
309 0.14
310 0.13
311 0.12
312 0.12
313 0.13
314 0.14
315 0.14
316 0.12
317 0.1
318 0.12
319 0.12
320 0.11
321 0.14
322 0.14
323 0.15
324 0.24
325 0.31
326 0.34
327 0.38
328 0.4
329 0.42
330 0.44
331 0.44
332 0.35
333 0.29
334 0.24
335 0.2
336 0.17
337 0.12
338 0.07
339 0.06
340 0.06
341 0.04
342 0.03
343 0.03
344 0.03
345 0.03
346 0.04
347 0.04
348 0.04
349 0.05
350 0.05
351 0.05
352 0.06
353 0.06
354 0.06
355 0.06
356 0.06
357 0.05
358 0.07
359 0.06
360 0.06
361 0.06
362 0.06
363 0.06
364 0.06
365 0.07
366 0.08
367 0.13
368 0.15
369 0.22
370 0.25
371 0.29
372 0.34
373 0.39
374 0.42
375 0.42
376 0.43
377 0.41
378 0.42
379 0.4
380 0.36
381 0.32
382 0.3
383 0.26
384 0.23
385 0.17
386 0.15
387 0.16
388 0.14
389 0.14
390 0.17
391 0.2
392 0.2
393 0.2
394 0.2
395 0.2
396 0.2
397 0.2
398 0.14
399 0.12
400 0.12
401 0.15
402 0.15
403 0.17
404 0.2
405 0.21
406 0.25
407 0.29
408 0.34
409 0.39
410 0.44
411 0.47
412 0.5
413 0.5
414 0.47
415 0.45
416 0.41
417 0.33
418 0.28
419 0.25
420 0.21
421 0.2
422 0.19
423 0.17
424 0.16
425 0.16
426 0.16
427 0.12
428 0.11
429 0.12
430 0.13
431 0.14
432 0.15
433 0.14
434 0.13
435 0.12
436 0.11
437 0.13
438 0.2
439 0.25
440 0.3
441 0.32
442 0.32
443 0.33
444 0.37
445 0.4
446 0.36
447 0.3
448 0.25
449 0.25
450 0.25
451 0.23
452 0.19
453 0.11
454 0.08
455 0.08
456 0.05
457 0.04
458 0.04
459 0.04
460 0.04
461 0.04
462 0.05
463 0.05
464 0.05
465 0.05
466 0.05
467 0.06
468 0.07
469 0.07
470 0.07
471 0.07
472 0.08
473 0.08
474 0.1
475 0.1
476 0.11
477 0.12
478 0.12
479 0.12
480 0.13
481 0.15
482 0.16
483 0.17
484 0.18
485 0.17
486 0.17
487 0.17
488 0.16
489 0.14
490 0.11
491 0.11
492 0.08
493 0.07
494 0.08
495 0.1
496 0.1
497 0.13
498 0.23
499 0.32
500 0.42
501 0.48
502 0.55
503 0.61
504 0.71
505 0.79
506 0.8
507 0.82
508 0.82
509 0.85
510 0.82
511 0.82