Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094I5V2

Protein Details
Accession A0A094I5V2    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
167-187AGLRQNQKKERIRKEFEKSPEHydrophilic
NLS Segment(s)
PositionSequence
48-94KNSSKKDAEAAKKLELARKKAEKEALLAEEEKSLKSAPKSSKAAPKK
Subcellular Location(s) nucl 17, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR010422  Ccdc124/Oxs1  
Pfam View protein in Pfam  
PF06244  Ccdc124  
Amino Acid Sequences MAGKKNFGENGKKVSGNAQKAEAAAAKAAAAQQSQAKVEEEDWGRGAKNSSKKDAEAAKKLELARKKAEKEALLAEEEKSLKSAPKSSKAAPKKTSRGLDLAQLDDAPSGPAKSLNATGIDNALDALTLTSGTDAKVEKHPERRYKAAYAAFEERRLAEMEEDGSGAGLRQNQKKERIRKEFEKSPENPFNNVSVAYDATKEEVAAIKEAEKKKIEDRLGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.51
3 0.48
4 0.46
5 0.41
6 0.38
7 0.37
8 0.39
9 0.31
10 0.23
11 0.17
12 0.15
13 0.12
14 0.11
15 0.12
16 0.11
17 0.09
18 0.1
19 0.13
20 0.15
21 0.16
22 0.17
23 0.17
24 0.17
25 0.17
26 0.23
27 0.21
28 0.21
29 0.21
30 0.2
31 0.19
32 0.2
33 0.22
34 0.22
35 0.29
36 0.32
37 0.38
38 0.39
39 0.4
40 0.44
41 0.5
42 0.5
43 0.49
44 0.48
45 0.43
46 0.45
47 0.46
48 0.46
49 0.43
50 0.41
51 0.42
52 0.46
53 0.46
54 0.47
55 0.5
56 0.45
57 0.42
58 0.4
59 0.33
60 0.28
61 0.26
62 0.21
63 0.19
64 0.19
65 0.16
66 0.13
67 0.12
68 0.12
69 0.13
70 0.2
71 0.21
72 0.28
73 0.32
74 0.36
75 0.45
76 0.51
77 0.58
78 0.58
79 0.61
80 0.6
81 0.63
82 0.62
83 0.54
84 0.49
85 0.42
86 0.41
87 0.34
88 0.28
89 0.21
90 0.18
91 0.16
92 0.12
93 0.11
94 0.06
95 0.05
96 0.04
97 0.04
98 0.05
99 0.05
100 0.06
101 0.07
102 0.07
103 0.08
104 0.09
105 0.09
106 0.09
107 0.08
108 0.07
109 0.06
110 0.05
111 0.04
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.04
119 0.04
120 0.05
121 0.06
122 0.08
123 0.13
124 0.19
125 0.24
126 0.33
127 0.41
128 0.48
129 0.53
130 0.57
131 0.57
132 0.54
133 0.56
134 0.52
135 0.46
136 0.41
137 0.43
138 0.39
139 0.36
140 0.33
141 0.27
142 0.23
143 0.23
144 0.18
145 0.12
146 0.11
147 0.11
148 0.1
149 0.1
150 0.08
151 0.07
152 0.06
153 0.06
154 0.06
155 0.1
156 0.15
157 0.21
158 0.29
159 0.35
160 0.45
161 0.54
162 0.63
163 0.7
164 0.75
165 0.78
166 0.79
167 0.82
168 0.81
169 0.79
170 0.78
171 0.7
172 0.7
173 0.71
174 0.64
175 0.58
176 0.51
177 0.46
178 0.38
179 0.36
180 0.27
181 0.19
182 0.18
183 0.16
184 0.16
185 0.14
186 0.14
187 0.14
188 0.12
189 0.12
190 0.14
191 0.14
192 0.15
193 0.15
194 0.18
195 0.26
196 0.29
197 0.34
198 0.34
199 0.37
200 0.42
201 0.5