Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094FRU1

Protein Details
Accession A0A094FRU1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
20-42RDAGLQKEKKHRRQACPAKCQLAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, extr 9, cyto 4.5, cyto_nucl 3.5
Family & Domain DBs
Amino Acid Sequences MPRGLMICMAITVGYGRPLRDAGLQKEKKHRRQACPAKCQLAPTGSESSLAADIPRQESGTDEGDRRGVDGAARATQRTDSIVPDAPSGVRHGEAGACNAPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.14
5 0.15
6 0.16
7 0.21
8 0.27
9 0.29
10 0.39
11 0.44
12 0.48
13 0.58
14 0.67
15 0.7
16 0.75
17 0.77
18 0.74
19 0.8
20 0.86
21 0.85
22 0.85
23 0.81
24 0.75
25 0.66
26 0.6
27 0.51
28 0.42
29 0.33
30 0.27
31 0.24
32 0.19
33 0.19
34 0.17
35 0.15
36 0.13
37 0.11
38 0.08
39 0.06
40 0.07
41 0.07
42 0.08
43 0.07
44 0.07
45 0.08
46 0.11
47 0.14
48 0.15
49 0.14
50 0.15
51 0.16
52 0.16
53 0.15
54 0.13
55 0.09
56 0.08
57 0.11
58 0.12
59 0.14
60 0.15
61 0.15
62 0.15
63 0.16
64 0.16
65 0.17
66 0.16
67 0.14
68 0.17
69 0.21
70 0.22
71 0.21
72 0.22
73 0.19
74 0.18
75 0.19
76 0.16
77 0.12
78 0.12
79 0.12
80 0.14
81 0.15
82 0.19