Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094FBX4

Protein Details
Accession A0A094FBX4    Localization Confidence High Confidence Score 20.5
NoLS Segment(s)
PositionSequenceProtein Nature
30-58DEELKEIERCKKKKDRERRSKTSARASQHBasic
231-257TAKSAKLEETKRQKQREKEKAASSSKSHydrophilic
NLS Segment(s)
PositionSequence
40-59KKKKDRERRSKTSARASQHR
234-265SAKLEETKRQKQREKEKAASSSKSGSSSGKKR
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
Amino Acid Sequences MSEQSSQSDSDSDSDSDSDSDSDSDSTDEDEELKEIERCKKKKDRERRSKTSARASQHRTAKAKNQDINTPPAGPSQFNLGNDTPPSEPSELSDKWGQILNPTTALVKDVRVCEDTGSSVNFISPSIVDACNLNRYATKSRAYEGVEGVPFTVNEFVKPRWLGQGVIQGIDIFYIAPKATPIELLVGRDFIRDNGDVFMSEKPTKPAYLNVPKKMTNDEKREMEANKAAATAKSAKLEETKRQKQREKEKAASSSKSGSSSGKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.15
5 0.14
6 0.12
7 0.12
8 0.11
9 0.11
10 0.11
11 0.11
12 0.1
13 0.11
14 0.1
15 0.1
16 0.1
17 0.1
18 0.1
19 0.1
20 0.12
21 0.13
22 0.16
23 0.26
24 0.35
25 0.38
26 0.47
27 0.56
28 0.66
29 0.74
30 0.81
31 0.83
32 0.85
33 0.92
34 0.92
35 0.91
36 0.9
37 0.87
38 0.87
39 0.83
40 0.79
41 0.78
42 0.75
43 0.74
44 0.73
45 0.73
46 0.67
47 0.64
48 0.65
49 0.66
50 0.67
51 0.64
52 0.59
53 0.58
54 0.57
55 0.57
56 0.5
57 0.41
58 0.33
59 0.31
60 0.3
61 0.22
62 0.19
63 0.2
64 0.21
65 0.2
66 0.24
67 0.22
68 0.22
69 0.22
70 0.24
71 0.18
72 0.16
73 0.19
74 0.15
75 0.14
76 0.14
77 0.2
78 0.18
79 0.21
80 0.22
81 0.19
82 0.19
83 0.22
84 0.19
85 0.16
86 0.19
87 0.16
88 0.15
89 0.15
90 0.14
91 0.12
92 0.14
93 0.11
94 0.09
95 0.11
96 0.12
97 0.13
98 0.14
99 0.14
100 0.13
101 0.13
102 0.13
103 0.11
104 0.11
105 0.09
106 0.08
107 0.08
108 0.07
109 0.07
110 0.06
111 0.05
112 0.05
113 0.07
114 0.07
115 0.07
116 0.08
117 0.08
118 0.11
119 0.11
120 0.11
121 0.1
122 0.14
123 0.18
124 0.21
125 0.24
126 0.22
127 0.22
128 0.26
129 0.27
130 0.25
131 0.21
132 0.21
133 0.17
134 0.16
135 0.15
136 0.12
137 0.09
138 0.08
139 0.11
140 0.08
141 0.09
142 0.12
143 0.12
144 0.16
145 0.17
146 0.17
147 0.17
148 0.19
149 0.18
150 0.18
151 0.25
152 0.21
153 0.21
154 0.2
155 0.16
156 0.15
157 0.14
158 0.11
159 0.04
160 0.03
161 0.04
162 0.04
163 0.04
164 0.04
165 0.05
166 0.06
167 0.06
168 0.07
169 0.09
170 0.1
171 0.12
172 0.12
173 0.13
174 0.13
175 0.13
176 0.13
177 0.1
178 0.13
179 0.11
180 0.12
181 0.12
182 0.12
183 0.12
184 0.13
185 0.14
186 0.16
187 0.17
188 0.18
189 0.2
190 0.21
191 0.23
192 0.22
193 0.26
194 0.31
195 0.4
196 0.47
197 0.51
198 0.54
199 0.56
200 0.56
201 0.59
202 0.59
203 0.58
204 0.57
205 0.57
206 0.56
207 0.56
208 0.59
209 0.52
210 0.48
211 0.43
212 0.36
213 0.3
214 0.28
215 0.26
216 0.21
217 0.23
218 0.22
219 0.21
220 0.23
221 0.23
222 0.24
223 0.31
224 0.36
225 0.42
226 0.49
227 0.56
228 0.62
229 0.72
230 0.78
231 0.81
232 0.87
233 0.87
234 0.87
235 0.85
236 0.84
237 0.84
238 0.83
239 0.77
240 0.7
241 0.64
242 0.57
243 0.51
244 0.44
245 0.41