Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094GBI8

Protein Details
Accession A0A094GBI8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
186-205LFLRDLELRRRERKEKRKEVBasic
NLS Segment(s)
PositionSequence
194-204RRRERKEKRKE
Subcellular Location(s) mito 17, extr 4, plas 2, cyto 1, pero 1, E.R. 1, vacu 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR002076  ELO_fam  
Gene Ontology GO:0016020  C:membrane  
GO:0009922  F:fatty acid elongase activity  
GO:0102756  F:very-long-chain 3-ketoacyl-CoA synthase activity  
GO:0006633  P:fatty acid biosynthetic process  
Pfam View protein in Pfam  
PF01151  ELO  
Amino Acid Sequences MTLMLSQSALFITLWLTLRRHVSLRGPIPGARTLTTINSWFYALVSLGLLLITLSPPHDLLARRLYHASKFYEYVDILNVLASGGEIDLHFGVHHLTTMYLTYARVLHHSEGWRIFAALNTAHHVLMYAFFGGATWVRPALPWTGAVQLLVGIATDVWVGRGKMKRGEEVWPNFFGGGILATYFVLFLRDLELRRRERKEKRKEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.16
4 0.19
5 0.23
6 0.25
7 0.27
8 0.28
9 0.32
10 0.38
11 0.41
12 0.43
13 0.42
14 0.41
15 0.42
16 0.42
17 0.37
18 0.29
19 0.27
20 0.23
21 0.23
22 0.24
23 0.22
24 0.19
25 0.18
26 0.17
27 0.15
28 0.14
29 0.12
30 0.1
31 0.08
32 0.07
33 0.06
34 0.05
35 0.05
36 0.05
37 0.03
38 0.03
39 0.03
40 0.03
41 0.04
42 0.05
43 0.05
44 0.06
45 0.09
46 0.11
47 0.14
48 0.21
49 0.22
50 0.23
51 0.26
52 0.27
53 0.27
54 0.3
55 0.3
56 0.25
57 0.25
58 0.24
59 0.24
60 0.23
61 0.2
62 0.16
63 0.13
64 0.11
65 0.09
66 0.08
67 0.05
68 0.05
69 0.04
70 0.03
71 0.02
72 0.03
73 0.03
74 0.03
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.05
87 0.05
88 0.05
89 0.06
90 0.07
91 0.07
92 0.08
93 0.1
94 0.1
95 0.13
96 0.15
97 0.17
98 0.16
99 0.17
100 0.16
101 0.14
102 0.14
103 0.1
104 0.11
105 0.09
106 0.09
107 0.1
108 0.11
109 0.1
110 0.1
111 0.1
112 0.08
113 0.08
114 0.08
115 0.06
116 0.05
117 0.04
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.06
124 0.06
125 0.06
126 0.08
127 0.09
128 0.1
129 0.1
130 0.11
131 0.12
132 0.13
133 0.12
134 0.11
135 0.09
136 0.08
137 0.07
138 0.05
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.04
145 0.06
146 0.07
147 0.13
148 0.18
149 0.21
150 0.28
151 0.31
152 0.35
153 0.36
154 0.42
155 0.45
156 0.48
157 0.49
158 0.43
159 0.41
160 0.36
161 0.34
162 0.27
163 0.18
164 0.11
165 0.07
166 0.06
167 0.06
168 0.06
169 0.06
170 0.06
171 0.05
172 0.06
173 0.06
174 0.06
175 0.09
176 0.13
177 0.15
178 0.23
179 0.32
180 0.39
181 0.48
182 0.57
183 0.63
184 0.71
185 0.8