Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094HGS0

Protein Details
Accession A0A094HGS0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
88-111KVVTSSERRSRPRTKQPGNREWVTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto_pero 5.333, cyto 5, pero 4.5, cyto_nucl 4.333
Family & Domain DBs
Amino Acid Sequences MADRLCMDRDASRVGSRWAHRFVKRYPELTMAFRRRIDYQRAKCEDSEVVKAWFALVRNVIAKYGIQEADIYNFDETGFLMGMLSSAKVVTSSERRSRPRTKQPGNREWVTVIQGICATGWAIPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.33
3 0.35
4 0.39
5 0.42
6 0.47
7 0.5
8 0.54
9 0.55
10 0.58
11 0.59
12 0.55
13 0.5
14 0.49
15 0.47
16 0.47
17 0.52
18 0.46
19 0.46
20 0.45
21 0.44
22 0.43
23 0.45
24 0.5
25 0.5
26 0.53
27 0.58
28 0.62
29 0.61
30 0.56
31 0.54
32 0.47
33 0.4
34 0.35
35 0.27
36 0.23
37 0.2
38 0.2
39 0.17
40 0.15
41 0.12
42 0.1
43 0.09
44 0.09
45 0.1
46 0.1
47 0.1
48 0.09
49 0.09
50 0.08
51 0.1
52 0.09
53 0.08
54 0.08
55 0.08
56 0.1
57 0.11
58 0.1
59 0.08
60 0.08
61 0.08
62 0.07
63 0.07
64 0.06
65 0.05
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.03
73 0.03
74 0.03
75 0.04
76 0.04
77 0.09
78 0.15
79 0.22
80 0.3
81 0.38
82 0.45
83 0.53
84 0.62
85 0.68
86 0.73
87 0.77
88 0.8
89 0.83
90 0.87
91 0.89
92 0.87
93 0.79
94 0.71
95 0.62
96 0.54
97 0.47
98 0.4
99 0.3
100 0.23
101 0.21
102 0.19
103 0.16
104 0.13
105 0.1