Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179U591

Protein Details
Accession A0A179U591   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
57-83FNSWPRSTGWTRRRRRRPQYADLSLQPHydrophilic
NLS Segment(s)
PositionSequence
70-71RR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MNKLSVLNDDWKFFLHYYEAVTDTKVDGQLMRLTQKISPNFSSSTPIDEADHCGRAFNSWPRSTGWTRRRRRRPQYADLSLQPAEPLHTEPEKCHSQPAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.17
3 0.16
4 0.16
5 0.18
6 0.19
7 0.16
8 0.16
9 0.15
10 0.14
11 0.15
12 0.13
13 0.11
14 0.09
15 0.11
16 0.13
17 0.14
18 0.16
19 0.15
20 0.15
21 0.18
22 0.24
23 0.25
24 0.26
25 0.27
26 0.27
27 0.28
28 0.27
29 0.29
30 0.23
31 0.23
32 0.2
33 0.18
34 0.17
35 0.16
36 0.19
37 0.16
38 0.18
39 0.14
40 0.14
41 0.13
42 0.13
43 0.17
44 0.19
45 0.24
46 0.23
47 0.24
48 0.26
49 0.31
50 0.35
51 0.42
52 0.45
53 0.49
54 0.59
55 0.68
56 0.78
57 0.83
58 0.89
59 0.91
60 0.9
61 0.9
62 0.9
63 0.87
64 0.81
65 0.73
66 0.67
67 0.56
68 0.47
69 0.37
70 0.26
71 0.2
72 0.16
73 0.15
74 0.16
75 0.2
76 0.21
77 0.23
78 0.29
79 0.35
80 0.34