Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094IK97

Protein Details
Accession A0A094IK97   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-42CRPAKATWRKLPARRYPSSRRAPARPRRRQRIRRKMALISRFHydrophilic
NLS Segment(s)
PositionSequence
6-35ATWRKLPARRYPSSRRAPARPRRRQRIRRK
Subcellular Location(s) mito 11, nucl 10.5, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences CRPAKATWRKLPARRYPSSRRAPARPRRRQRIRRKMALISRFDLNLPKSIVTRLAKGVLPPSTQIQGNAMLAMTKSATVFVGYLATHANEYAQAANRKTVAPADVLKALEDLEFGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.79
3 0.79
4 0.8
5 0.82
6 0.82
7 0.78
8 0.79
9 0.81
10 0.84
11 0.85
12 0.86
13 0.87
14 0.88
15 0.92
16 0.93
17 0.94
18 0.95
19 0.93
20 0.92
21 0.87
22 0.84
23 0.82
24 0.79
25 0.71
26 0.62
27 0.54
28 0.44
29 0.39
30 0.34
31 0.26
32 0.21
33 0.18
34 0.16
35 0.15
36 0.16
37 0.21
38 0.18
39 0.19
40 0.17
41 0.18
42 0.17
43 0.17
44 0.2
45 0.15
46 0.14
47 0.14
48 0.14
49 0.14
50 0.14
51 0.13
52 0.12
53 0.11
54 0.11
55 0.1
56 0.08
57 0.07
58 0.06
59 0.07
60 0.05
61 0.04
62 0.04
63 0.04
64 0.05
65 0.05
66 0.05
67 0.05
68 0.06
69 0.06
70 0.06
71 0.07
72 0.07
73 0.07
74 0.07
75 0.07
76 0.06
77 0.07
78 0.09
79 0.15
80 0.19
81 0.2
82 0.23
83 0.24
84 0.24
85 0.24
86 0.24
87 0.19
88 0.18
89 0.19
90 0.2
91 0.22
92 0.22
93 0.21
94 0.2
95 0.19
96 0.15