Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094FLU8

Protein Details
Accession A0A094FLU8   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
3-26TTKPPTTTKPTDPKPPRPSQRLFVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000340  Dual-sp_phosphatase_cat-dom  
IPR029021  Prot-tyrosine_phosphatase-like  
IPR016130  Tyr_Pase_AS  
IPR000387  Tyr_Pase_dom  
IPR020422  TYR_PHOSPHATASE_DUAL_dom  
Gene Ontology GO:0004725  F:protein tyrosine phosphatase activity  
GO:0008138  F:protein tyrosine/serine/threonine phosphatase activity  
GO:0006470  P:protein dephosphorylation  
Pfam View protein in Pfam  
PF00782  DSPc  
PROSITE View protein in PROSITE  
PS00383  TYR_PHOSPHATASE_1  
PS50056  TYR_PHOSPHATASE_2  
CDD cd14498  DSP  
Amino Acid Sequences MDTTKPPTTTKPTDPKPPRPSQRLFVACLDNSTQDMLIHLSGICDFIDRQLDAGIGSPPRESESEGYASLFPEEELQRLKKIESESWTRGGAPRVMVHCEKGYSRSPMVLIAYLMRRRKEGLDKVVQDVRGKRRMKPNPNFMEQLRVWESVEYEIWEDEGKTVPKAAYAEYLRGRKERLEEQGLTGDEPIGVQSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.8
3 0.81
4 0.84
5 0.84
6 0.83
7 0.82
8 0.78
9 0.79
10 0.72
11 0.66
12 0.6
13 0.55
14 0.47
15 0.43
16 0.38
17 0.29
18 0.25
19 0.22
20 0.17
21 0.12
22 0.12
23 0.11
24 0.09
25 0.09
26 0.08
27 0.07
28 0.07
29 0.08
30 0.07
31 0.07
32 0.07
33 0.08
34 0.11
35 0.1
36 0.11
37 0.1
38 0.11
39 0.1
40 0.11
41 0.11
42 0.09
43 0.1
44 0.09
45 0.09
46 0.11
47 0.12
48 0.13
49 0.12
50 0.14
51 0.16
52 0.16
53 0.17
54 0.15
55 0.14
56 0.13
57 0.11
58 0.08
59 0.09
60 0.09
61 0.1
62 0.13
63 0.14
64 0.15
65 0.16
66 0.16
67 0.16
68 0.18
69 0.2
70 0.22
71 0.27
72 0.28
73 0.29
74 0.3
75 0.27
76 0.26
77 0.24
78 0.21
79 0.16
80 0.16
81 0.15
82 0.18
83 0.18
84 0.17
85 0.16
86 0.16
87 0.15
88 0.16
89 0.17
90 0.17
91 0.17
92 0.16
93 0.16
94 0.16
95 0.16
96 0.13
97 0.1
98 0.09
99 0.13
100 0.17
101 0.21
102 0.2
103 0.2
104 0.21
105 0.25
106 0.32
107 0.34
108 0.37
109 0.41
110 0.42
111 0.46
112 0.47
113 0.45
114 0.4
115 0.4
116 0.4
117 0.41
118 0.41
119 0.43
120 0.5
121 0.59
122 0.66
123 0.69
124 0.73
125 0.71
126 0.74
127 0.72
128 0.62
129 0.6
130 0.49
131 0.45
132 0.38
133 0.32
134 0.27
135 0.24
136 0.24
137 0.18
138 0.19
139 0.14
140 0.11
141 0.1
142 0.11
143 0.1
144 0.1
145 0.09
146 0.13
147 0.13
148 0.12
149 0.14
150 0.14
151 0.16
152 0.17
153 0.17
154 0.2
155 0.21
156 0.27
157 0.32
158 0.37
159 0.38
160 0.4
161 0.41
162 0.37
163 0.41
164 0.42
165 0.43
166 0.45
167 0.44
168 0.44
169 0.48
170 0.45
171 0.4
172 0.33
173 0.25
174 0.17
175 0.16