Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094G680

Protein Details
Accession A0A094G680    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
75-95ASCVSGKKRKRGEGKEEEEETBasic
NLS Segment(s)
PositionSequence
81-85KKRKR
Subcellular Location(s) mito 15, cyto 11
Family & Domain DBs
Amino Acid Sequences MLKFRSLFKLSAYKEARATCAAIEDGLCLLVQLHNDLELLLIEQTCASTILEDVAARVKEVGEEVGKVPVAVVAASCVSGKKRKRGEGKEEEEETVTANFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.45
3 0.43
4 0.35
5 0.33
6 0.23
7 0.22
8 0.19
9 0.14
10 0.13
11 0.1
12 0.08
13 0.08
14 0.07
15 0.05
16 0.05
17 0.06
18 0.06
19 0.06
20 0.06
21 0.06
22 0.06
23 0.06
24 0.06
25 0.05
26 0.05
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.05
39 0.05
40 0.05
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.06
47 0.07
48 0.08
49 0.06
50 0.07
51 0.07
52 0.09
53 0.09
54 0.08
55 0.08
56 0.07
57 0.07
58 0.06
59 0.05
60 0.05
61 0.05
62 0.06
63 0.06
64 0.07
65 0.1
66 0.19
67 0.24
68 0.33
69 0.41
70 0.5
71 0.61
72 0.69
73 0.76
74 0.79
75 0.82
76 0.8
77 0.75
78 0.67
79 0.58
80 0.49
81 0.4