Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094FN89

Protein Details
Accession A0A094FN89    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
287-306TGSPAKKPGKAAPPAKKKGKBasic
NLS Segment(s)
PositionSequence
289-306SPAKKPGKAAPPAKKKGK
Subcellular Location(s) nucl 19.5, cyto_nucl 14, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR037830  ZZZ3  
Amino Acid Sequences MPALTVETTSPNSSSPHTALRNGAPPYAPHGSASPQHSRPSSPPQPPYSPITPTLAAARLDTNVPALPQQPLRTYTHSKPDATFIPPPPAPVEVIDFDSNTDVLAVKSAISVLQLQKKKAAQDIRTLQRFKNQAMEDPEAFLRAADLGEIRTDGDATFPEISEEEEEDDDEGDGDVEMNGTEDRETKGDEQKDASMKNGTSHTKTHTSFPPLPVPQKVVKVPPINWAKYGVIGDSLDKLHDDQLRHPTPGSPARLGPDGQVLNGYTSTEAEMRHPSPQSPAGTLKATGSPAKKPGKAAPPAKKKGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.3
4 0.32
5 0.34
6 0.37
7 0.4
8 0.44
9 0.41
10 0.4
11 0.33
12 0.31
13 0.34
14 0.35
15 0.3
16 0.24
17 0.24
18 0.25
19 0.29
20 0.34
21 0.36
22 0.35
23 0.4
24 0.41
25 0.43
26 0.45
27 0.49
28 0.53
29 0.53
30 0.57
31 0.59
32 0.62
33 0.62
34 0.63
35 0.56
36 0.51
37 0.44
38 0.41
39 0.35
40 0.31
41 0.3
42 0.27
43 0.23
44 0.21
45 0.19
46 0.16
47 0.16
48 0.15
49 0.14
50 0.11
51 0.11
52 0.11
53 0.12
54 0.14
55 0.17
56 0.19
57 0.21
58 0.24
59 0.28
60 0.33
61 0.38
62 0.4
63 0.46
64 0.48
65 0.46
66 0.44
67 0.44
68 0.4
69 0.38
70 0.39
71 0.31
72 0.34
73 0.32
74 0.32
75 0.3
76 0.27
77 0.24
78 0.19
79 0.19
80 0.14
81 0.17
82 0.16
83 0.15
84 0.14
85 0.14
86 0.13
87 0.1
88 0.09
89 0.06
90 0.05
91 0.06
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.08
99 0.11
100 0.19
101 0.22
102 0.22
103 0.27
104 0.29
105 0.3
106 0.34
107 0.37
108 0.32
109 0.38
110 0.46
111 0.49
112 0.54
113 0.54
114 0.48
115 0.47
116 0.47
117 0.39
118 0.39
119 0.32
120 0.3
121 0.34
122 0.36
123 0.3
124 0.29
125 0.28
126 0.21
127 0.2
128 0.15
129 0.09
130 0.06
131 0.06
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.06
144 0.06
145 0.06
146 0.06
147 0.06
148 0.07
149 0.07
150 0.07
151 0.06
152 0.06
153 0.06
154 0.06
155 0.06
156 0.06
157 0.05
158 0.05
159 0.04
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.04
167 0.04
168 0.04
169 0.05
170 0.06
171 0.07
172 0.09
173 0.12
174 0.18
175 0.2
176 0.21
177 0.22
178 0.24
179 0.27
180 0.26
181 0.25
182 0.21
183 0.2
184 0.21
185 0.25
186 0.24
187 0.23
188 0.25
189 0.28
190 0.32
191 0.33
192 0.35
193 0.35
194 0.4
195 0.41
196 0.43
197 0.46
198 0.43
199 0.45
200 0.43
201 0.42
202 0.38
203 0.38
204 0.38
205 0.34
206 0.37
207 0.39
208 0.38
209 0.43
210 0.47
211 0.43
212 0.42
213 0.41
214 0.34
215 0.31
216 0.3
217 0.22
218 0.16
219 0.15
220 0.14
221 0.13
222 0.13
223 0.1
224 0.11
225 0.11
226 0.14
227 0.18
228 0.19
229 0.22
230 0.32
231 0.35
232 0.35
233 0.35
234 0.32
235 0.36
236 0.41
237 0.41
238 0.33
239 0.32
240 0.34
241 0.36
242 0.34
243 0.29
244 0.28
245 0.24
246 0.21
247 0.21
248 0.18
249 0.17
250 0.17
251 0.16
252 0.1
253 0.1
254 0.12
255 0.12
256 0.12
257 0.13
258 0.19
259 0.2
260 0.25
261 0.27
262 0.26
263 0.3
264 0.35
265 0.35
266 0.33
267 0.35
268 0.34
269 0.34
270 0.34
271 0.3
272 0.27
273 0.28
274 0.3
275 0.29
276 0.31
277 0.38
278 0.45
279 0.46
280 0.48
281 0.54
282 0.57
283 0.64
284 0.69
285 0.71
286 0.74