Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094ETR1

Protein Details
Accession A0A094ETR1    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
188-224KLCTAGAKKICRKIRKAKKKKGKKGKKGKKTSGCLTSBasic
NLS Segment(s)
PositionSequence
195-217KKICRKIRKAKKKKGKKGKKGKK
Subcellular Location(s) cyto 10.5, cyto_mito 9.833, mito_nucl 8.833, nucl 8.5, mito 8
Family & Domain DBs
Amino Acid Sequences MSPADKAALRKRLQEIKESIELCATAPFSRVLQMPQEELKKLMLNLGEQRPTREPGNTMRREVMKLQGLKFRAFCRYAQIWDTVGKQYEAMDAAEARLHNHKGATVVELLAAIDVLKKYLATSDKILEHGFDLIKMLHDDEALTLRQLVSAQGEATVHRQDRVFYLIEASHVTISIFKFCEAVSKPFKLCTAGAKKICRKIRKAKKKKGKKGKKGKKTSGCLTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.57
3 0.54
4 0.59
5 0.53
6 0.45
7 0.37
8 0.35
9 0.27
10 0.24
11 0.19
12 0.12
13 0.13
14 0.14
15 0.13
16 0.15
17 0.16
18 0.15
19 0.2
20 0.21
21 0.23
22 0.28
23 0.31
24 0.29
25 0.29
26 0.29
27 0.25
28 0.24
29 0.23
30 0.19
31 0.19
32 0.25
33 0.29
34 0.33
35 0.31
36 0.36
37 0.36
38 0.38
39 0.36
40 0.31
41 0.29
42 0.33
43 0.43
44 0.42
45 0.42
46 0.43
47 0.43
48 0.44
49 0.43
50 0.39
51 0.35
52 0.36
53 0.36
54 0.37
55 0.37
56 0.36
57 0.37
58 0.33
59 0.31
60 0.29
61 0.27
62 0.28
63 0.29
64 0.29
65 0.28
66 0.28
67 0.24
68 0.24
69 0.26
70 0.2
71 0.19
72 0.16
73 0.14
74 0.13
75 0.12
76 0.11
77 0.09
78 0.07
79 0.06
80 0.06
81 0.08
82 0.08
83 0.08
84 0.11
85 0.11
86 0.11
87 0.11
88 0.12
89 0.12
90 0.12
91 0.12
92 0.09
93 0.08
94 0.08
95 0.07
96 0.07
97 0.05
98 0.04
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.07
107 0.09
108 0.1
109 0.12
110 0.14
111 0.15
112 0.17
113 0.17
114 0.14
115 0.13
116 0.12
117 0.11
118 0.08
119 0.08
120 0.07
121 0.07
122 0.07
123 0.08
124 0.06
125 0.06
126 0.06
127 0.06
128 0.08
129 0.07
130 0.07
131 0.07
132 0.07
133 0.07
134 0.07
135 0.07
136 0.06
137 0.07
138 0.07
139 0.07
140 0.08
141 0.08
142 0.11
143 0.15
144 0.14
145 0.15
146 0.15
147 0.15
148 0.17
149 0.19
150 0.18
151 0.13
152 0.15
153 0.14
154 0.15
155 0.15
156 0.14
157 0.11
158 0.1
159 0.1
160 0.1
161 0.1
162 0.13
163 0.12
164 0.12
165 0.12
166 0.12
167 0.19
168 0.2
169 0.27
170 0.3
171 0.34
172 0.34
173 0.36
174 0.38
175 0.33
176 0.31
177 0.34
178 0.37
179 0.41
180 0.47
181 0.54
182 0.61
183 0.67
184 0.75
185 0.74
186 0.75
187 0.77
188 0.82
189 0.84
190 0.88
191 0.9
192 0.92
193 0.95
194 0.96
195 0.97
196 0.97
197 0.96
198 0.97
199 0.96
200 0.96
201 0.96
202 0.96
203 0.95
204 0.92