Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094G582

Protein Details
Accession A0A094G582   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
159-186ENRLLRSENTRQKKKKMKRKSYIATGGVHydrophilic
NLS Segment(s)
PositionSequence
169-178RQKKKKMKRK
Subcellular Location(s) nucl 16, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004875  DDE_SF_endonuclease_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF03184  DDE_1  
Amino Acid Sequences MPPHSSHLLQPLDVGCFAAVKRAYGRRIEGYMRDGLNHIDKPDFLTAYNETRQETLILDNIRSGFAATGLISHDPNRVLEKLHITLRTPTPPINQQPASSPWNPETPHNIRELERQTKTIKEYIQRRTQSPPSPTDLALNQLVKGCQMAMHNAVLLAEENRLLRSENTRQKKKKMKRKSYIATGGVLGLEEVITDCLQEPRIRAPNKCSICKSLEHNARKCPDRSSSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.14
3 0.13
4 0.13
5 0.17
6 0.16
7 0.15
8 0.22
9 0.28
10 0.32
11 0.34
12 0.39
13 0.37
14 0.41
15 0.43
16 0.4
17 0.38
18 0.39
19 0.35
20 0.32
21 0.28
22 0.27
23 0.28
24 0.26
25 0.24
26 0.2
27 0.19
28 0.22
29 0.24
30 0.21
31 0.16
32 0.18
33 0.2
34 0.24
35 0.27
36 0.25
37 0.23
38 0.23
39 0.23
40 0.2
41 0.18
42 0.14
43 0.16
44 0.16
45 0.15
46 0.16
47 0.16
48 0.15
49 0.14
50 0.13
51 0.08
52 0.07
53 0.07
54 0.05
55 0.06
56 0.07
57 0.08
58 0.08
59 0.09
60 0.11
61 0.11
62 0.12
63 0.14
64 0.14
65 0.14
66 0.16
67 0.19
68 0.2
69 0.23
70 0.23
71 0.22
72 0.25
73 0.27
74 0.28
75 0.25
76 0.24
77 0.24
78 0.29
79 0.31
80 0.34
81 0.32
82 0.29
83 0.31
84 0.33
85 0.35
86 0.3
87 0.28
88 0.23
89 0.26
90 0.27
91 0.25
92 0.29
93 0.28
94 0.29
95 0.29
96 0.29
97 0.26
98 0.31
99 0.35
100 0.34
101 0.31
102 0.32
103 0.31
104 0.32
105 0.33
106 0.31
107 0.28
108 0.28
109 0.34
110 0.39
111 0.47
112 0.46
113 0.46
114 0.49
115 0.53
116 0.52
117 0.49
118 0.45
119 0.41
120 0.4
121 0.39
122 0.34
123 0.28
124 0.24
125 0.23
126 0.2
127 0.16
128 0.15
129 0.15
130 0.13
131 0.12
132 0.09
133 0.08
134 0.08
135 0.1
136 0.1
137 0.11
138 0.1
139 0.1
140 0.1
141 0.09
142 0.08
143 0.07
144 0.05
145 0.06
146 0.07
147 0.07
148 0.08
149 0.09
150 0.1
151 0.16
152 0.25
153 0.34
154 0.44
155 0.55
156 0.61
157 0.69
158 0.79
159 0.83
160 0.84
161 0.86
162 0.87
163 0.87
164 0.92
165 0.9
166 0.89
167 0.88
168 0.79
169 0.69
170 0.58
171 0.48
172 0.37
173 0.28
174 0.17
175 0.08
176 0.06
177 0.04
178 0.04
179 0.05
180 0.05
181 0.05
182 0.06
183 0.08
184 0.11
185 0.13
186 0.14
187 0.22
188 0.31
189 0.36
190 0.39
191 0.44
192 0.52
193 0.58
194 0.64
195 0.6
196 0.56
197 0.55
198 0.56
199 0.55
200 0.56
201 0.59
202 0.61
203 0.62
204 0.65
205 0.69
206 0.71
207 0.67
208 0.62