Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094FZZ5

Protein Details
Accession A0A094FZZ5    Localization Confidence High Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
89-113SARAKEKMEKLRRERAHRRGKNASABasic
NLS Segment(s)
PositionSequence
60-69KPKKASAKAR
90-114ARAKEKMEKLRRERAHRRGKNASAH
125-136SEAGHRSRRKKA
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MAQLSQSESEVPTAEPPSSEPEMVLRLVCGWNDKTNTYLYRDEVINPPPLYGNGPERVSKPKKASAKARLSRAEDVKFCSADAKPSNVSARAKEKMEKLRRERAHRRGKNASAHQQPSPASTPASEAGHRSRRKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.15
4 0.2
5 0.21
6 0.21
7 0.17
8 0.17
9 0.19
10 0.19
11 0.18
12 0.12
13 0.11
14 0.12
15 0.12
16 0.14
17 0.15
18 0.19
19 0.21
20 0.22
21 0.22
22 0.25
23 0.26
24 0.27
25 0.27
26 0.23
27 0.24
28 0.24
29 0.25
30 0.25
31 0.25
32 0.27
33 0.24
34 0.23
35 0.21
36 0.21
37 0.2
38 0.18
39 0.19
40 0.17
41 0.18
42 0.19
43 0.21
44 0.3
45 0.32
46 0.35
47 0.36
48 0.39
49 0.44
50 0.49
51 0.56
52 0.57
53 0.64
54 0.63
55 0.65
56 0.63
57 0.6
58 0.58
59 0.54
60 0.47
61 0.37
62 0.36
63 0.32
64 0.27
65 0.23
66 0.21
67 0.17
68 0.2
69 0.2
70 0.19
71 0.18
72 0.2
73 0.22
74 0.24
75 0.26
76 0.24
77 0.29
78 0.3
79 0.31
80 0.33
81 0.38
82 0.44
83 0.52
84 0.58
85 0.59
86 0.65
87 0.71
88 0.77
89 0.8
90 0.8
91 0.82
92 0.79
93 0.81
94 0.8
95 0.8
96 0.79
97 0.78
98 0.77
99 0.75
100 0.72
101 0.64
102 0.59
103 0.53
104 0.48
105 0.43
106 0.35
107 0.26
108 0.23
109 0.24
110 0.24
111 0.26
112 0.23
113 0.23
114 0.3
115 0.39
116 0.47