Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094GLG6

Protein Details
Accession A0A094GLG6    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
14-42KALQAANEQKKRRERKRKRRIMQGGSLSVHydrophilic
NLS Segment(s)
PositionSequence
23-33KKRRERKRKRR
Subcellular Location(s) mito 12.5, mito_nucl 10.499, cyto_nucl 7.333, nucl 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MMMHSAVLLKAEVKALQAANEQKKRRERKRKRRIMQGGSLSVQDAEDILQSAEVDAQVRTEVASESSRQVGSKGQQKRCGRCEKIGHNTLLSRLVVYGYGRRQYPVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.14
4 0.19
5 0.26
6 0.35
7 0.42
8 0.46
9 0.5
10 0.6
11 0.69
12 0.75
13 0.78
14 0.8
15 0.83
16 0.91
17 0.94
18 0.93
19 0.94
20 0.93
21 0.89
22 0.86
23 0.81
24 0.73
25 0.63
26 0.54
27 0.43
28 0.32
29 0.24
30 0.15
31 0.08
32 0.05
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.06
50 0.07
51 0.08
52 0.09
53 0.11
54 0.11
55 0.11
56 0.12
57 0.14
58 0.18
59 0.25
60 0.33
61 0.38
62 0.47
63 0.55
64 0.62
65 0.67
66 0.72
67 0.69
68 0.68
69 0.71
70 0.71
71 0.73
72 0.71
73 0.65
74 0.58
75 0.54
76 0.47
77 0.42
78 0.33
79 0.23
80 0.17
81 0.16
82 0.14
83 0.15
84 0.2
85 0.22
86 0.26
87 0.27