Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094HUR0

Protein Details
Accession A0A094HUR0    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-22ETINKLLKKQAPKTNARRRDLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006880  INO80B_C  
Gene Ontology GO:0031011  C:Ino80 complex  
Pfam View protein in Pfam  
PF04795  PAPA-1  
Amino Acid Sequences METINKLLKKQAPKTNARRRDLNGLGGEIGPDGEPGKPNSSYVRWISNKEGNKICVPSEMVESPVGRLFAGGGKMVEEVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.8
3 0.83
4 0.79
5 0.77
6 0.72
7 0.73
8 0.65
9 0.6
10 0.5
11 0.41
12 0.37
13 0.3
14 0.25
15 0.16
16 0.13
17 0.07
18 0.06
19 0.05
20 0.05
21 0.07
22 0.08
23 0.11
24 0.11
25 0.12
26 0.14
27 0.15
28 0.18
29 0.19
30 0.26
31 0.25
32 0.28
33 0.32
34 0.36
35 0.39
36 0.4
37 0.42
38 0.37
39 0.38
40 0.36
41 0.32
42 0.27
43 0.25
44 0.2
45 0.21
46 0.19
47 0.18
48 0.18
49 0.18
50 0.17
51 0.17
52 0.16
53 0.12
54 0.11
55 0.1
56 0.11
57 0.13
58 0.12
59 0.11
60 0.11