Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094FTQ9

Protein Details
Accession A0A094FTQ9    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-40MPPPRRKKRAQGGKELAKERKERQEKTRKRPPSLFRKAKIBasic
NLS Segment(s)
PositionSequence
4-38PRRKKRAQGGKELAKERKERQEKTRKRPPSLFRKA
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MPPPRRKKRAQGGKELAKERKERQEKTRKRPPSLFRKAKILATDTDAWVNLTVLYASGKCDTFTSSDDPNWPNQDMRATYPLGKHEFLRKQISDTGFWKPVLEDGNDTDAGDRLISAVAPSRADNPLQIVNNTRRLETEEINAQVLKLEEANAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.84
3 0.79
4 0.75
5 0.73
6 0.68
7 0.69
8 0.69
9 0.68
10 0.7
11 0.75
12 0.79
13 0.82
14 0.86
15 0.84
16 0.83
17 0.86
18 0.85
19 0.85
20 0.85
21 0.85
22 0.78
23 0.77
24 0.71
25 0.65
26 0.59
27 0.5
28 0.4
29 0.36
30 0.34
31 0.27
32 0.24
33 0.21
34 0.18
35 0.15
36 0.14
37 0.08
38 0.06
39 0.05
40 0.05
41 0.06
42 0.05
43 0.06
44 0.08
45 0.08
46 0.08
47 0.09
48 0.1
49 0.11
50 0.13
51 0.14
52 0.15
53 0.16
54 0.19
55 0.2
56 0.21
57 0.22
58 0.21
59 0.18
60 0.17
61 0.19
62 0.16
63 0.17
64 0.17
65 0.15
66 0.16
67 0.17
68 0.2
69 0.2
70 0.2
71 0.19
72 0.25
73 0.28
74 0.31
75 0.36
76 0.32
77 0.32
78 0.36
79 0.37
80 0.32
81 0.3
82 0.31
83 0.27
84 0.27
85 0.25
86 0.2
87 0.2
88 0.19
89 0.18
90 0.14
91 0.13
92 0.17
93 0.16
94 0.16
95 0.14
96 0.12
97 0.12
98 0.1
99 0.08
100 0.05
101 0.05
102 0.05
103 0.05
104 0.08
105 0.09
106 0.1
107 0.11
108 0.14
109 0.15
110 0.16
111 0.16
112 0.16
113 0.21
114 0.22
115 0.23
116 0.27
117 0.31
118 0.39
119 0.39
120 0.36
121 0.32
122 0.35
123 0.38
124 0.34
125 0.33
126 0.31
127 0.31
128 0.33
129 0.32
130 0.27
131 0.24
132 0.22
133 0.18
134 0.12