Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094I106

Protein Details
Accession A0A094I106    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
150-175SSAAKAGSPDKKRKRVSKRGEEMVAAHydrophilic
NLS Segment(s)
PositionSequence
122-191ATPKGKARGKKVGGKVITPAPEPAAIVPSSAAKAGSPDKKRKRVSKRGEEMVAAAGEEEKGKGRKKGRGQ
Subcellular Location(s) cyto 16, cyto_nucl 13.5, nucl 9
Family & Domain DBs
Amino Acid Sequences MQTARPIIAGDLGPEVAKGAVSNEGVRRWRDMEDYDKSLWTGVYTENLRLYNARTHAYKSGIATAKDMTDDEARAYADTHNISTAPAEISANDQLNAESLLDLPAADAASLPSSPEAAVAKATPKGKARGKKVGGKVITPAPEPAAIVPSSAAKAGSPDKKRKRVSKRGEEMVAAAGEEEKGKGRKKGRGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.08
4 0.08
5 0.07
6 0.06
7 0.09
8 0.11
9 0.14
10 0.16
11 0.21
12 0.26
13 0.27
14 0.29
15 0.28
16 0.29
17 0.3
18 0.31
19 0.33
20 0.35
21 0.38
22 0.36
23 0.35
24 0.32
25 0.29
26 0.25
27 0.18
28 0.13
29 0.09
30 0.13
31 0.14
32 0.16
33 0.18
34 0.18
35 0.19
36 0.18
37 0.2
38 0.2
39 0.21
40 0.23
41 0.21
42 0.24
43 0.26
44 0.28
45 0.27
46 0.23
47 0.28
48 0.29
49 0.28
50 0.26
51 0.24
52 0.21
53 0.2
54 0.19
55 0.13
56 0.11
57 0.11
58 0.1
59 0.1
60 0.1
61 0.09
62 0.1
63 0.08
64 0.09
65 0.1
66 0.1
67 0.09
68 0.09
69 0.09
70 0.08
71 0.08
72 0.06
73 0.06
74 0.06
75 0.05
76 0.07
77 0.09
78 0.1
79 0.09
80 0.09
81 0.08
82 0.09
83 0.09
84 0.07
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.03
94 0.03
95 0.03
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.06
103 0.06
104 0.06
105 0.06
106 0.07
107 0.09
108 0.13
109 0.14
110 0.16
111 0.19
112 0.27
113 0.33
114 0.41
115 0.46
116 0.52
117 0.57
118 0.62
119 0.64
120 0.65
121 0.6
122 0.53
123 0.49
124 0.44
125 0.4
126 0.32
127 0.27
128 0.2
129 0.19
130 0.18
131 0.15
132 0.13
133 0.11
134 0.1
135 0.1
136 0.09
137 0.1
138 0.1
139 0.09
140 0.07
141 0.1
142 0.17
143 0.26
144 0.33
145 0.43
146 0.53
147 0.63
148 0.72
149 0.8
150 0.83
151 0.86
152 0.88
153 0.89
154 0.88
155 0.87
156 0.81
157 0.71
158 0.62
159 0.54
160 0.43
161 0.31
162 0.22
163 0.14
164 0.11
165 0.1
166 0.1
167 0.12
168 0.18
169 0.23
170 0.31
171 0.38