Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094FJ67

Protein Details
Accession A0A094FJ67    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
61-99EDRAKEREKERKREEKKVRKENKKIEKQNKKLEKEREKEBasic
NLS Segment(s)
PositionSequence
63-103RAKEREKERKREEKKVRKENKKIEKQNKKLEKEREKEMRKK
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MSSEPRTITSLSTKRDLRRCEMAIESDEAVHKSNLFVLEIRQIQHERLLNYEKDKTKEIEEDRAKEREKERKREEKKVRKENKKIEKQNKKLEKEREKEMRKKDGYEPRASFCWIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.58
3 0.6
4 0.56
5 0.58
6 0.56
7 0.52
8 0.49
9 0.44
10 0.38
11 0.36
12 0.29
13 0.22
14 0.21
15 0.18
16 0.17
17 0.14
18 0.12
19 0.09
20 0.11
21 0.11
22 0.11
23 0.1
24 0.1
25 0.15
26 0.16
27 0.17
28 0.18
29 0.18
30 0.18
31 0.22
32 0.23
33 0.19
34 0.21
35 0.24
36 0.22
37 0.24
38 0.3
39 0.29
40 0.28
41 0.3
42 0.28
43 0.26
44 0.3
45 0.29
46 0.33
47 0.33
48 0.35
49 0.36
50 0.39
51 0.38
52 0.37
53 0.41
54 0.42
55 0.47
56 0.53
57 0.59
58 0.66
59 0.72
60 0.78
61 0.83
62 0.84
63 0.86
64 0.87
65 0.89
66 0.88
67 0.92
68 0.91
69 0.91
70 0.91
71 0.91
72 0.91
73 0.92
74 0.9
75 0.91
76 0.9
77 0.87
78 0.85
79 0.85
80 0.85
81 0.79
82 0.79
83 0.79
84 0.79
85 0.79
86 0.79
87 0.79
88 0.73
89 0.72
90 0.72
91 0.72
92 0.7
93 0.71
94 0.66
95 0.6
96 0.59