Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094GHK8

Protein Details
Accession A0A094GHK8    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
89-114VSARAKEKMEKLRKERVERRGKVNNPBasic
NLS Segment(s)
PositionSequence
58-110VSKRPKKASAKVRSSRTDDVKIASAGAKPSNVSARAKEKMEKLRKERVERRGK
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MAQPSQPDSEVPTAEPPSSESKDVLRLVCGWNDKTNTYLYRDEVINPPPLYGNGPERVSKRPKKASAKVRSSRTDDVKIASAGAKPSNVSARAKEKMEKLRKERVERRGKVNNPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.21
4 0.25
5 0.27
6 0.26
7 0.23
8 0.23
9 0.28
10 0.31
11 0.28
12 0.23
13 0.22
14 0.22
15 0.25
16 0.27
17 0.23
18 0.25
19 0.27
20 0.26
21 0.25
22 0.27
23 0.25
24 0.26
25 0.25
26 0.22
27 0.23
28 0.23
29 0.23
30 0.23
31 0.23
32 0.25
33 0.23
34 0.21
35 0.19
36 0.19
37 0.18
38 0.17
39 0.17
40 0.15
41 0.16
42 0.19
43 0.21
44 0.26
45 0.34
46 0.39
47 0.44
48 0.49
49 0.56
50 0.63
51 0.69
52 0.74
53 0.75
54 0.79
55 0.79
56 0.77
57 0.74
58 0.71
59 0.68
60 0.63
61 0.57
62 0.48
63 0.42
64 0.37
65 0.32
66 0.26
67 0.21
68 0.18
69 0.15
70 0.15
71 0.13
72 0.11
73 0.14
74 0.17
75 0.19
76 0.2
77 0.24
78 0.3
79 0.34
80 0.37
81 0.39
82 0.43
83 0.51
84 0.58
85 0.63
86 0.63
87 0.69
88 0.75
89 0.8
90 0.82
91 0.82
92 0.83
93 0.79
94 0.82
95 0.82