Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094FDM1

Protein Details
Accession A0A094FDM1    Localization Confidence High Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
39-62ITDPAERRKRQNRINQRLYRRRHQHydrophilic
NLS Segment(s)
PositionSequence
46-51RKRQNR
55-55R
58-60RRR
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 3
Family & Domain DBs
Amino Acid Sequences METAPVWVAGEEAMAPMIPLVQMRQQAIVSVSEEDWVGITDPAERRKRQNRINQRLYRRRHQGSSNRVKPSESKTKGVGSQIPKDKLDDGDSSEANSPDTKLVTKLPQEDGPTQYATSPPPTPNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.04
6 0.05
7 0.06
8 0.1
9 0.13
10 0.14
11 0.16
12 0.15
13 0.16
14 0.17
15 0.17
16 0.14
17 0.13
18 0.12
19 0.11
20 0.11
21 0.09
22 0.08
23 0.07
24 0.07
25 0.06
26 0.06
27 0.09
28 0.12
29 0.2
30 0.26
31 0.28
32 0.36
33 0.45
34 0.54
35 0.59
36 0.67
37 0.7
38 0.75
39 0.84
40 0.83
41 0.85
42 0.85
43 0.82
44 0.8
45 0.77
46 0.7
47 0.64
48 0.64
49 0.62
50 0.63
51 0.68
52 0.67
53 0.63
54 0.59
55 0.56
56 0.51
57 0.5
58 0.5
59 0.43
60 0.38
61 0.36
62 0.38
63 0.39
64 0.39
65 0.38
66 0.32
67 0.36
68 0.41
69 0.41
70 0.39
71 0.39
72 0.37
73 0.33
74 0.31
75 0.25
76 0.21
77 0.21
78 0.21
79 0.21
80 0.22
81 0.2
82 0.18
83 0.17
84 0.14
85 0.12
86 0.14
87 0.13
88 0.12
89 0.16
90 0.21
91 0.25
92 0.29
93 0.32
94 0.34
95 0.38
96 0.4
97 0.4
98 0.37
99 0.34
100 0.3
101 0.27
102 0.25
103 0.23
104 0.24
105 0.25