Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094FW49

Protein Details
Accession A0A094FW49   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
108-134AERLRVSEARKRRWRRRFGMKERPGKEBasic
NLS Segment(s)
PositionSequence
115-132EARKRRWRRRFGMKERPG
221-224KGKK
Subcellular Location(s) mito 12, cyto 7.5, mito_nucl 7.5, cyto_pero 5.5
Family & Domain DBs
Amino Acid Sequences MPEYVNLTSTITATTTAPSPDKTLTIYRHSKNRLFTFETASTEPAEYVVATTKSATKSRWTPLLYRGPSAVFAPESPIIGSMRRTAFWTKLTLELGDGVGQLEHNRDAERLRVSEARKRRWRRRFGMKERPGKEMEDVEVSGLVLGVCMERRPRVGRAMRWEFDGVEYVWTGTREMARSWFKRVKGYSHDMKLVRTCDHALIATYEKKHFGRSAGPGMDGKGKKRPIGMLRIYPAAYDCPQTDTVRGLDGEMTQEVRLAPRHRMGSNMTGTHTGNIFEEAVVMACWAALEAEHRIRHTILDILIVIAENAGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.16
4 0.17
5 0.18
6 0.21
7 0.21
8 0.22
9 0.24
10 0.29
11 0.3
12 0.37
13 0.45
14 0.47
15 0.55
16 0.62
17 0.63
18 0.65
19 0.67
20 0.65
21 0.62
22 0.59
23 0.57
24 0.53
25 0.52
26 0.44
27 0.39
28 0.33
29 0.27
30 0.25
31 0.17
32 0.14
33 0.1
34 0.09
35 0.12
36 0.11
37 0.11
38 0.12
39 0.16
40 0.19
41 0.23
42 0.23
43 0.26
44 0.32
45 0.37
46 0.43
47 0.42
48 0.42
49 0.48
50 0.57
51 0.52
52 0.47
53 0.43
54 0.36
55 0.34
56 0.31
57 0.25
58 0.15
59 0.13
60 0.15
61 0.14
62 0.14
63 0.13
64 0.14
65 0.12
66 0.13
67 0.14
68 0.15
69 0.16
70 0.16
71 0.19
72 0.21
73 0.23
74 0.24
75 0.26
76 0.22
77 0.24
78 0.25
79 0.22
80 0.19
81 0.17
82 0.15
83 0.12
84 0.1
85 0.07
86 0.06
87 0.06
88 0.06
89 0.07
90 0.07
91 0.07
92 0.08
93 0.09
94 0.1
95 0.13
96 0.15
97 0.15
98 0.17
99 0.22
100 0.24
101 0.31
102 0.39
103 0.46
104 0.53
105 0.63
106 0.7
107 0.75
108 0.83
109 0.84
110 0.87
111 0.88
112 0.88
113 0.89
114 0.88
115 0.88
116 0.8
117 0.76
118 0.66
119 0.56
120 0.47
121 0.37
122 0.29
123 0.21
124 0.18
125 0.13
126 0.12
127 0.1
128 0.08
129 0.06
130 0.05
131 0.03
132 0.03
133 0.03
134 0.03
135 0.04
136 0.05
137 0.06
138 0.09
139 0.11
140 0.13
141 0.22
142 0.27
143 0.3
144 0.38
145 0.44
146 0.43
147 0.42
148 0.4
149 0.32
150 0.28
151 0.25
152 0.16
153 0.1
154 0.09
155 0.07
156 0.07
157 0.08
158 0.07
159 0.07
160 0.08
161 0.08
162 0.09
163 0.15
164 0.21
165 0.22
166 0.29
167 0.34
168 0.34
169 0.39
170 0.41
171 0.4
172 0.41
173 0.46
174 0.46
175 0.44
176 0.49
177 0.43
178 0.43
179 0.41
180 0.37
181 0.31
182 0.26
183 0.24
184 0.18
185 0.18
186 0.16
187 0.13
188 0.13
189 0.15
190 0.16
191 0.17
192 0.17
193 0.2
194 0.21
195 0.23
196 0.22
197 0.21
198 0.23
199 0.26
200 0.32
201 0.29
202 0.3
203 0.28
204 0.28
205 0.34
206 0.3
207 0.28
208 0.29
209 0.31
210 0.32
211 0.33
212 0.39
213 0.37
214 0.44
215 0.47
216 0.45
217 0.45
218 0.46
219 0.43
220 0.37
221 0.32
222 0.26
223 0.21
224 0.18
225 0.16
226 0.17
227 0.2
228 0.21
229 0.21
230 0.2
231 0.19
232 0.19
233 0.19
234 0.15
235 0.13
236 0.13
237 0.13
238 0.12
239 0.13
240 0.1
241 0.11
242 0.11
243 0.12
244 0.17
245 0.18
246 0.22
247 0.27
248 0.32
249 0.32
250 0.35
251 0.37
252 0.39
253 0.42
254 0.39
255 0.35
256 0.33
257 0.34
258 0.32
259 0.28
260 0.21
261 0.16
262 0.16
263 0.15
264 0.11
265 0.11
266 0.09
267 0.09
268 0.08
269 0.07
270 0.05
271 0.04
272 0.04
273 0.04
274 0.04
275 0.04
276 0.06
277 0.11
278 0.18
279 0.21
280 0.22
281 0.24
282 0.25
283 0.26
284 0.26
285 0.25
286 0.19
287 0.19
288 0.18
289 0.16
290 0.16
291 0.14
292 0.12