Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179U0Z7

Protein Details
Accession A0A179U0Z7    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
31-55LTDSRMSRKLRRRYKRSYPPKGVLDHydrophilic
NLS Segment(s)
PositionSequence
38-46RKLRRRYKR
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
PROSITE View protein in PROSITE  
PS50088  ANK_REPEAT  
Amino Acid Sequences MVANLPMIIRKARMYRARAMKPLCGATFIYLTDSRMSRKLRRRYKRSYPPKGVLDRALTAASYENDVDLLKILLAKGANVDHEDMFFGNALYTAIFLKNIEATTLLSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.49
3 0.57
4 0.62
5 0.65
6 0.63
7 0.58
8 0.55
9 0.54
10 0.45
11 0.37
12 0.32
13 0.26
14 0.24
15 0.19
16 0.19
17 0.15
18 0.16
19 0.16
20 0.16
21 0.16
22 0.21
23 0.26
24 0.31
25 0.4
26 0.5
27 0.58
28 0.68
29 0.74
30 0.78
31 0.84
32 0.87
33 0.88
34 0.88
35 0.86
36 0.82
37 0.8
38 0.74
39 0.65
40 0.57
41 0.47
42 0.37
43 0.3
44 0.24
45 0.16
46 0.13
47 0.12
48 0.09
49 0.08
50 0.07
51 0.06
52 0.07
53 0.07
54 0.06
55 0.05
56 0.05
57 0.04
58 0.05
59 0.05
60 0.06
61 0.06
62 0.06
63 0.07
64 0.08
65 0.09
66 0.1
67 0.12
68 0.1
69 0.1
70 0.11
71 0.1
72 0.1
73 0.09
74 0.08
75 0.06
76 0.06
77 0.06
78 0.05
79 0.06
80 0.06
81 0.07
82 0.07
83 0.07
84 0.09
85 0.11
86 0.11
87 0.11
88 0.11