Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094GZF4

Protein Details
Accession A0A094GZF4    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
86-113VSARAKEKMERLRRERAKRRGKVSYNSLHydrophilic
NLS Segment(s)
PositionSequence
55-107VSKRPKKASAKAKLSRGDDVKFAAADAKPSNVSARAKEKMERLRRERAKRRGK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MAQPPQSDSEVPTASSEPEDVLRLVCGWNDKTNTYLYRDEVINPPPLYGDGPERVSKRPKKASAKAKLSRGDDVKFAAADAKPSNVSARAKEKMERLRRERAKRRGKVSYNSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.17
4 0.12
5 0.12
6 0.13
7 0.11
8 0.11
9 0.1
10 0.1
11 0.1
12 0.1
13 0.13
14 0.14
15 0.19
16 0.2
17 0.2
18 0.21
19 0.25
20 0.26
21 0.26
22 0.26
23 0.23
24 0.23
25 0.23
26 0.24
27 0.24
28 0.24
29 0.25
30 0.23
31 0.22
32 0.19
33 0.19
34 0.17
35 0.15
36 0.15
37 0.11
38 0.14
39 0.17
40 0.19
41 0.21
42 0.3
43 0.34
44 0.4
45 0.46
46 0.52
47 0.58
48 0.65
49 0.72
50 0.74
51 0.78
52 0.76
53 0.75
54 0.72
55 0.65
56 0.62
57 0.55
58 0.46
59 0.37
60 0.32
61 0.26
62 0.2
63 0.18
64 0.16
65 0.12
66 0.14
67 0.13
68 0.14
69 0.13
70 0.14
71 0.16
72 0.18
73 0.2
74 0.22
75 0.28
76 0.31
77 0.33
78 0.37
79 0.44
80 0.49
81 0.57
82 0.62
83 0.61
84 0.68
85 0.75
86 0.82
87 0.85
88 0.85
89 0.86
90 0.85
91 0.88
92 0.87
93 0.86