Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094FPU7

Protein Details
Accession A0A094FPU7    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MPKETKTKRATKPRGEKKKKGQVGKVLBasic
NLS Segment(s)
PositionSequence
6-25KTKRATKPRGEKKKKGQVGK
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MPKETKTKRATKPRGEKKKKGQVGKVLGERWKALNDKQRTPYETKAQEDKKRYEDEKASYNADAEEESG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.92
4 0.91
5 0.92
6 0.89
7 0.86
8 0.82
9 0.8
10 0.77
11 0.74
12 0.68
13 0.61
14 0.56
15 0.48
16 0.42
17 0.34
18 0.29
19 0.25
20 0.24
21 0.29
22 0.31
23 0.36
24 0.41
25 0.44
26 0.45
27 0.48
28 0.48
29 0.48
30 0.48
31 0.46
32 0.49
33 0.54
34 0.58
35 0.6
36 0.6
37 0.57
38 0.59
39 0.57
40 0.56
41 0.54
42 0.5
43 0.51
44 0.49
45 0.46
46 0.39
47 0.38
48 0.31
49 0.25