Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094HTM7

Protein Details
Accession A0A094HTM7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
19-39RLSLRRLKPLRCRHRTHRGGVBasic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MSKRRQHDRLLPLRRQLIRLSLRRLKPLRCRHRTHRGGVDAVVQLQVSGGCGDDARSQEGQGEHLAQLDVDAQGGLAVSDERLDGVRGDGADEVCGGEDEPAAHGGHEEADAGEGDGDPC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.65
3 0.56
4 0.55
5 0.54
6 0.54
7 0.56
8 0.56
9 0.57
10 0.63
11 0.67
12 0.66
13 0.67
14 0.71
15 0.73
16 0.74
17 0.79
18 0.78
19 0.84
20 0.82
21 0.79
22 0.76
23 0.69
24 0.62
25 0.54
26 0.49
27 0.38
28 0.31
29 0.24
30 0.15
31 0.11
32 0.09
33 0.08
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.05
40 0.07
41 0.08
42 0.1
43 0.1
44 0.1
45 0.12
46 0.13
47 0.12
48 0.11
49 0.11
50 0.09
51 0.09
52 0.09
53 0.06
54 0.06
55 0.06
56 0.05
57 0.04
58 0.04
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.04
69 0.04
70 0.05
71 0.05
72 0.06
73 0.07
74 0.07
75 0.08
76 0.09
77 0.08
78 0.08
79 0.08
80 0.07
81 0.06
82 0.07
83 0.06
84 0.05
85 0.05
86 0.06
87 0.07
88 0.08
89 0.08
90 0.08
91 0.08
92 0.08
93 0.08
94 0.08
95 0.07
96 0.06
97 0.07
98 0.07
99 0.07
100 0.07