Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q75AP5

Protein Details
Accession Q75AP5    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
7-30HTAHNQTKKAHRNGIKKPRTNKYPHydrophilic
NLS Segment(s)
PositionSequence
14-62KKAHRNGIKKPRTNKYPSLKGVDAKFKRNHKYALHGTAKALAAKRAAKN
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
KEGG ago:AGOS_ADL125C  -  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTAHNQTKKAHRNGIKKPRTNKYPSLKGVDAKFKRNHKYALHGTAKALAAKRAAKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.75
3 0.75
4 0.72
5 0.72
6 0.75
7 0.8
8 0.81
9 0.79
10 0.81
11 0.8
12 0.8
13 0.76
14 0.75
15 0.72
16 0.71
17 0.67
18 0.65
19 0.57
20 0.53
21 0.5
22 0.51
23 0.45
24 0.44
25 0.47
26 0.49
27 0.54
28 0.55
29 0.58
30 0.5
31 0.56
32 0.57
33 0.6
34 0.58
35 0.52
36 0.48
37 0.46
38 0.45
39 0.4
40 0.34
41 0.27
42 0.26