Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094GDD4

Protein Details
Accession A0A094GDD4    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-40KALQAANEQKKRRERKRKRRIMQGGSLSVHydrophilic
NLS Segment(s)
PositionSequence
21-31KKRRERKRKRR
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MHSAILLKAEVKALQAANEQKKRRERKRKRRIMQGGSLSVREGEDILQTAEVDAQIRTEVASEATQQRIIHRPEKGAVRIDLRETIIKLLYDRTNTDNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.19
3 0.27
4 0.35
5 0.43
6 0.46
7 0.51
8 0.6
9 0.69
10 0.75
11 0.78
12 0.8
13 0.83
14 0.91
15 0.94
16 0.93
17 0.94
18 0.93
19 0.89
20 0.86
21 0.81
22 0.76
23 0.66
24 0.57
25 0.46
26 0.35
27 0.27
28 0.19
29 0.12
30 0.07
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.04
39 0.05
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.05
47 0.05
48 0.06
49 0.08
50 0.1
51 0.12
52 0.14
53 0.14
54 0.17
55 0.23
56 0.27
57 0.3
58 0.3
59 0.31
60 0.34
61 0.4
62 0.4
63 0.38
64 0.37
65 0.36
66 0.35
67 0.35
68 0.33
69 0.29
70 0.29
71 0.25
72 0.24
73 0.22
74 0.2
75 0.19
76 0.22
77 0.24
78 0.24
79 0.26