Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5G7L0

Protein Details
Accession C5G7L0   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
234-255AYIKGKEEKARREKARKEKAFVBasic
NLS Segment(s)
PositionSequence
49-50PR
57-61ARAPR
237-253KGKEEKARREKARKEKA
265-314PRGGRGGGRGGGGRGGGDRGRGGNGGRGGGGRGGEFRGGAGPRGGPRGGP
Subcellular Location(s) cyto_nucl 11, nucl 10.5, cyto 8.5, mito 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039764  HABP4/SERBP1  
IPR006861  HABP4_PAIRBP1-bd  
IPR019084  Stm1-like_N  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF09598  Stm1_N  
Amino Acid Sequences MSDVRSKNLYELLGNDPEEDSDREPSPPTSAITKAAPRYGKREGPSEPPRSANPANARAPRAGRAGGNRYGNEQAFRDHDASARANRSKPVDAPLPDIPTGVVKNRDVRGNLLREDRTNRSDRTETNKQVEQGWGATDGEANWDDERAAAASAKREKKEGPGSEPADAEAAAAAAAAAEAEDKAKSYAEYLAEQAEQRREDLGVKEARKPNEGVKADKKWATARQFKRDEDEEAYIKGKEEKARREKARKEKAFVEVDMRFVEQPRGGRGGGRGGGGRGGGDRGRGGNGGRGGGGRGGEFRGGAGPRGGPRGGPAAGPSVNVDEKNFPALGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.23
4 0.23
5 0.25
6 0.24
7 0.2
8 0.2
9 0.21
10 0.21
11 0.24
12 0.24
13 0.24
14 0.24
15 0.24
16 0.23
17 0.24
18 0.26
19 0.28
20 0.33
21 0.33
22 0.38
23 0.42
24 0.42
25 0.47
26 0.51
27 0.53
28 0.5
29 0.52
30 0.49
31 0.53
32 0.59
33 0.59
34 0.54
35 0.51
36 0.5
37 0.52
38 0.5
39 0.48
40 0.46
41 0.47
42 0.52
43 0.53
44 0.54
45 0.5
46 0.51
47 0.46
48 0.42
49 0.36
50 0.32
51 0.34
52 0.37
53 0.39
54 0.41
55 0.38
56 0.38
57 0.41
58 0.38
59 0.34
60 0.29
61 0.25
62 0.23
63 0.26
64 0.24
65 0.2
66 0.2
67 0.22
68 0.24
69 0.27
70 0.31
71 0.32
72 0.32
73 0.35
74 0.38
75 0.37
76 0.36
77 0.36
78 0.36
79 0.33
80 0.37
81 0.37
82 0.36
83 0.32
84 0.31
85 0.25
86 0.21
87 0.21
88 0.19
89 0.19
90 0.17
91 0.23
92 0.25
93 0.29
94 0.28
95 0.31
96 0.34
97 0.35
98 0.36
99 0.36
100 0.35
101 0.34
102 0.39
103 0.39
104 0.38
105 0.38
106 0.36
107 0.36
108 0.38
109 0.38
110 0.42
111 0.47
112 0.46
113 0.47
114 0.48
115 0.43
116 0.42
117 0.39
118 0.31
119 0.22
120 0.18
121 0.14
122 0.11
123 0.1
124 0.08
125 0.07
126 0.08
127 0.08
128 0.08
129 0.07
130 0.07
131 0.07
132 0.07
133 0.07
134 0.05
135 0.05
136 0.06
137 0.06
138 0.11
139 0.18
140 0.23
141 0.23
142 0.25
143 0.25
144 0.31
145 0.39
146 0.37
147 0.35
148 0.38
149 0.39
150 0.39
151 0.38
152 0.31
153 0.23
154 0.2
155 0.15
156 0.07
157 0.05
158 0.03
159 0.03
160 0.02
161 0.02
162 0.02
163 0.02
164 0.02
165 0.02
166 0.02
167 0.03
168 0.03
169 0.03
170 0.04
171 0.04
172 0.05
173 0.06
174 0.08
175 0.09
176 0.1
177 0.1
178 0.11
179 0.12
180 0.12
181 0.14
182 0.15
183 0.14
184 0.13
185 0.13
186 0.13
187 0.14
188 0.15
189 0.18
190 0.21
191 0.23
192 0.3
193 0.34
194 0.36
195 0.36
196 0.36
197 0.35
198 0.38
199 0.39
200 0.38
201 0.41
202 0.44
203 0.46
204 0.47
205 0.45
206 0.4
207 0.45
208 0.47
209 0.5
210 0.52
211 0.57
212 0.62
213 0.6
214 0.62
215 0.57
216 0.52
217 0.47
218 0.43
219 0.35
220 0.3
221 0.31
222 0.25
223 0.23
224 0.22
225 0.21
226 0.23
227 0.29
228 0.38
229 0.46
230 0.56
231 0.65
232 0.72
233 0.78
234 0.83
235 0.87
236 0.83
237 0.79
238 0.74
239 0.72
240 0.66
241 0.57
242 0.53
243 0.43
244 0.38
245 0.33
246 0.3
247 0.23
248 0.2
249 0.21
250 0.17
251 0.18
252 0.19
253 0.22
254 0.2
255 0.22
256 0.22
257 0.25
258 0.24
259 0.23
260 0.21
261 0.18
262 0.19
263 0.17
264 0.16
265 0.11
266 0.12
267 0.11
268 0.12
269 0.13
270 0.13
271 0.14
272 0.16
273 0.16
274 0.18
275 0.19
276 0.19
277 0.18
278 0.17
279 0.17
280 0.17
281 0.16
282 0.12
283 0.12
284 0.13
285 0.12
286 0.12
287 0.11
288 0.15
289 0.15
290 0.16
291 0.16
292 0.18
293 0.2
294 0.24
295 0.24
296 0.19
297 0.21
298 0.24
299 0.24
300 0.21
301 0.2
302 0.21
303 0.21
304 0.22
305 0.21
306 0.21
307 0.23
308 0.23
309 0.24
310 0.23
311 0.24
312 0.27
313 0.25