Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5GGP0

Protein Details
Accession C5GGP0    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
104-133VSEILKNKDRRRKAKSYARKEKLRKFFCRGBasic
NLS Segment(s)
PositionSequence
109-138KNKDRRRKAKSYARKEKLRKFFCRGSKPPK
Subcellular Location(s) mito 9, nucl 8.5, cyto_nucl 8.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MFEIKPTKRPSEHNSEVPPSKSPTKYLQLYTRLYPGHKALLAPSDTEPAQYFVVNKVPHKHASQWVPVFCRGDNPKYTPETTVIGRARRTAMWTSFKVWLGDGVSEILKNKDRRRKAKSYARKEKLRKFFCRGSKPPKEPLKDEEPVSGKVILVRMHRSGLSRKVEFEIEGTRYRWSGTRRFATGFMKGVKGWSHCLKLIRTSDHALIATFEKRRSAHYHRSIKTGQPPNKKKLFIGALRVYEEAYELPIGDNNGVGGSSVAAFTRRVDALASNPHSRAKDEKDLNPDGPHVGNLTEDMIMLSCWIVAEAEHRLRYKIFDVLQEIGENAGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.68
3 0.68
4 0.63
5 0.59
6 0.54
7 0.55
8 0.49
9 0.46
10 0.46
11 0.49
12 0.52
13 0.55
14 0.57
15 0.57
16 0.58
17 0.57
18 0.55
19 0.5
20 0.46
21 0.43
22 0.38
23 0.35
24 0.32
25 0.3
26 0.26
27 0.3
28 0.29
29 0.27
30 0.26
31 0.24
32 0.22
33 0.23
34 0.22
35 0.17
36 0.17
37 0.16
38 0.16
39 0.15
40 0.22
41 0.23
42 0.25
43 0.3
44 0.34
45 0.37
46 0.39
47 0.42
48 0.43
49 0.47
50 0.52
51 0.52
52 0.51
53 0.51
54 0.52
55 0.48
56 0.4
57 0.42
58 0.39
59 0.39
60 0.4
61 0.4
62 0.42
63 0.44
64 0.46
65 0.39
66 0.36
67 0.33
68 0.29
69 0.33
70 0.32
71 0.31
72 0.31
73 0.31
74 0.31
75 0.29
76 0.32
77 0.28
78 0.3
79 0.33
80 0.34
81 0.35
82 0.37
83 0.37
84 0.34
85 0.29
86 0.24
87 0.19
88 0.17
89 0.14
90 0.11
91 0.1
92 0.1
93 0.11
94 0.12
95 0.17
96 0.23
97 0.3
98 0.39
99 0.48
100 0.57
101 0.65
102 0.72
103 0.76
104 0.81
105 0.84
106 0.86
107 0.88
108 0.87
109 0.88
110 0.88
111 0.87
112 0.86
113 0.85
114 0.8
115 0.76
116 0.76
117 0.75
118 0.76
119 0.75
120 0.75
121 0.76
122 0.73
123 0.75
124 0.76
125 0.71
126 0.64
127 0.61
128 0.58
129 0.51
130 0.47
131 0.42
132 0.37
133 0.34
134 0.32
135 0.27
136 0.19
137 0.17
138 0.18
139 0.16
140 0.15
141 0.16
142 0.15
143 0.16
144 0.17
145 0.18
146 0.2
147 0.25
148 0.28
149 0.26
150 0.26
151 0.26
152 0.26
153 0.24
154 0.22
155 0.17
156 0.15
157 0.16
158 0.16
159 0.15
160 0.15
161 0.15
162 0.18
163 0.19
164 0.23
165 0.28
166 0.3
167 0.32
168 0.33
169 0.36
170 0.34
171 0.33
172 0.29
173 0.24
174 0.22
175 0.2
176 0.2
177 0.19
178 0.18
179 0.2
180 0.2
181 0.21
182 0.22
183 0.26
184 0.25
185 0.29
186 0.31
187 0.3
188 0.29
189 0.3
190 0.29
191 0.27
192 0.26
193 0.2
194 0.17
195 0.16
196 0.17
197 0.16
198 0.15
199 0.17
200 0.18
201 0.22
202 0.29
203 0.35
204 0.41
205 0.5
206 0.59
207 0.58
208 0.64
209 0.62
210 0.6
211 0.62
212 0.61
213 0.59
214 0.6
215 0.66
216 0.68
217 0.73
218 0.69
219 0.59
220 0.57
221 0.57
222 0.5
223 0.51
224 0.47
225 0.42
226 0.42
227 0.42
228 0.34
229 0.26
230 0.23
231 0.14
232 0.1
233 0.08
234 0.06
235 0.07
236 0.08
237 0.08
238 0.08
239 0.07
240 0.06
241 0.06
242 0.06
243 0.06
244 0.04
245 0.04
246 0.04
247 0.05
248 0.05
249 0.06
250 0.07
251 0.07
252 0.11
253 0.11
254 0.11
255 0.12
256 0.13
257 0.16
258 0.25
259 0.29
260 0.29
261 0.3
262 0.34
263 0.34
264 0.36
265 0.38
266 0.37
267 0.42
268 0.45
269 0.5
270 0.54
271 0.58
272 0.58
273 0.53
274 0.47
275 0.4
276 0.33
277 0.28
278 0.21
279 0.16
280 0.14
281 0.13
282 0.12
283 0.1
284 0.09
285 0.09
286 0.08
287 0.07
288 0.07
289 0.06
290 0.05
291 0.05
292 0.05
293 0.05
294 0.05
295 0.08
296 0.15
297 0.21
298 0.25
299 0.27
300 0.28
301 0.29
302 0.33
303 0.33
304 0.33
305 0.29
306 0.3
307 0.34
308 0.34
309 0.35
310 0.32
311 0.29