Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094DMI4

Protein Details
Accession A0A094DMI4   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPKETKTKRATKTRGEKKKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
6-27KTKRATKTRGEKKKKDPNAPKR
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKETKTKRATKTRGEKKKKDPNAPKRGLSAYMFFAQEQRDNVREENPGISFGQVGKVLGERWKALNDKQRTPYETKAQEDKKRYEDEKASYNADAEEESG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.89
3 0.89
4 0.89
5 0.92
6 0.91
7 0.91
8 0.91
9 0.91
10 0.91
11 0.88
12 0.8
13 0.73
14 0.65
15 0.58
16 0.48
17 0.39
18 0.31
19 0.27
20 0.25
21 0.21
22 0.2
23 0.18
24 0.18
25 0.17
26 0.17
27 0.17
28 0.18
29 0.19
30 0.19
31 0.19
32 0.18
33 0.18
34 0.15
35 0.14
36 0.13
37 0.12
38 0.1
39 0.08
40 0.09
41 0.08
42 0.07
43 0.06
44 0.07
45 0.07
46 0.1
47 0.11
48 0.11
49 0.12
50 0.16
51 0.18
52 0.23
53 0.31
54 0.34
55 0.4
56 0.46
57 0.5
58 0.51
59 0.54
60 0.55
61 0.55
62 0.55
63 0.53
64 0.55
65 0.59
66 0.63
67 0.65
68 0.64
69 0.61
70 0.63
71 0.61
72 0.59
73 0.57
74 0.54
75 0.54
76 0.52
77 0.49
78 0.41
79 0.4
80 0.32
81 0.26