Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094CYT9

Protein Details
Accession A0A094CYT9    Localization Confidence High Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-28CMDPSRAARRARKKAEKAARAAHydrophilic
63-89SQPGSMDKGRSRKKKGRRDERDGEEEEBasic
NLS Segment(s)
PositionSequence
12-59RAARRARKKAEKAARAAETAARTVERAKNDAAGLPRFPPTGREKPGAP
65-80PGSMDKGRSRKKKGRR
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MTDLNLCMDPSRAARRARKKAEKAARAAETAARTVERAKNDAAGLPRFPPTGREKPGAPWPDSQPGSMDKGRSRKKKGRRDERDGEEEEES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.55
3 0.64
4 0.73
5 0.78
6 0.79
7 0.84
8 0.87
9 0.84
10 0.79
11 0.76
12 0.67
13 0.58
14 0.5
15 0.43
16 0.34
17 0.27
18 0.22
19 0.15
20 0.13
21 0.16
22 0.18
23 0.17
24 0.17
25 0.17
26 0.18
27 0.18
28 0.2
29 0.19
30 0.17
31 0.16
32 0.15
33 0.15
34 0.14
35 0.14
36 0.16
37 0.2
38 0.27
39 0.3
40 0.31
41 0.31
42 0.35
43 0.43
44 0.43
45 0.38
46 0.34
47 0.34
48 0.4
49 0.4
50 0.37
51 0.3
52 0.28
53 0.31
54 0.29
55 0.29
56 0.27
57 0.36
58 0.46
59 0.53
60 0.61
61 0.65
62 0.74
63 0.8
64 0.86
65 0.88
66 0.88
67 0.89
68 0.89
69 0.88
70 0.85
71 0.78