Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094FIW3

Protein Details
Accession A0A094FIW3   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
147-179DPFWTPPPRPPRPPPRRRSRQQDRRSNSPKRSPBasic
NLS Segment(s)
PositionSequence
137-179PRPSPRRPPGDPFWTPPPRPPRPPPRRRSRQQDRRSNSPKRSP
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, extr 5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSTSNNASGVGITDPGEFARRSAAAIPDFNPYDALGIPAAAYTIDEVNQHFRRAQRHIVRASASAPAFPSRVDVNTARDYLLEVAARPAQRQRASYSRWESKPRTFYGELEIGDPGVFVSRATPRATPTPSPSGNGPRPSPRRPPGDPFWTPPPRPPRPPPRRRSRQQDRRSNSPKRSPPPTTPGSGTGAGTGTPGSARDGDFSGYTRRERTPPFGTSARNPYTVDDDDDEDDDEMPPPPTPTPSGTGTGSGTGAGRPSRARNAPPPPFAPFGFGRQAPPPPPPASPFGFTRPPTSGTGTGTPPPAPTPVSTSGTGTGTPPPSASMPRENRSTGATRARASPIANPVTGERIIVGTWAASPHAIPNAVVAIFDVRGRLNFRITNTTTTGAPVPAPTSTATSIRGINFRPPYAGLDLNALRVMINDHLHLPHEKRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.15
4 0.13
5 0.13
6 0.16
7 0.15
8 0.17
9 0.2
10 0.25
11 0.25
12 0.28
13 0.29
14 0.31
15 0.32
16 0.31
17 0.28
18 0.22
19 0.2
20 0.17
21 0.17
22 0.1
23 0.09
24 0.09
25 0.08
26 0.08
27 0.06
28 0.06
29 0.06
30 0.06
31 0.07
32 0.09
33 0.11
34 0.2
35 0.22
36 0.24
37 0.26
38 0.3
39 0.36
40 0.41
41 0.5
42 0.5
43 0.57
44 0.59
45 0.6
46 0.59
47 0.53
48 0.48
49 0.44
50 0.35
51 0.27
52 0.25
53 0.22
54 0.2
55 0.18
56 0.19
57 0.15
58 0.16
59 0.2
60 0.21
61 0.24
62 0.28
63 0.29
64 0.26
65 0.24
66 0.24
67 0.21
68 0.21
69 0.15
70 0.11
71 0.13
72 0.17
73 0.18
74 0.18
75 0.22
76 0.27
77 0.3
78 0.32
79 0.36
80 0.4
81 0.44
82 0.51
83 0.56
84 0.57
85 0.6
86 0.66
87 0.66
88 0.66
89 0.69
90 0.62
91 0.61
92 0.54
93 0.49
94 0.46
95 0.45
96 0.37
97 0.31
98 0.28
99 0.2
100 0.18
101 0.17
102 0.1
103 0.06
104 0.06
105 0.04
106 0.07
107 0.1
108 0.13
109 0.16
110 0.17
111 0.19
112 0.25
113 0.3
114 0.3
115 0.32
116 0.38
117 0.36
118 0.37
119 0.38
120 0.41
121 0.42
122 0.44
123 0.41
124 0.43
125 0.5
126 0.54
127 0.6
128 0.58
129 0.6
130 0.6
131 0.64
132 0.62
133 0.64
134 0.61
135 0.56
136 0.58
137 0.59
138 0.55
139 0.54
140 0.57
141 0.55
142 0.6
143 0.64
144 0.66
145 0.69
146 0.79
147 0.82
148 0.84
149 0.87
150 0.89
151 0.9
152 0.91
153 0.9
154 0.9
155 0.91
156 0.86
157 0.86
158 0.87
159 0.85
160 0.81
161 0.8
162 0.78
163 0.74
164 0.76
165 0.7
166 0.66
167 0.64
168 0.59
169 0.52
170 0.45
171 0.41
172 0.36
173 0.32
174 0.26
175 0.19
176 0.16
177 0.13
178 0.11
179 0.09
180 0.05
181 0.04
182 0.05
183 0.05
184 0.06
185 0.06
186 0.07
187 0.08
188 0.09
189 0.09
190 0.1
191 0.13
192 0.14
193 0.15
194 0.17
195 0.18
196 0.22
197 0.24
198 0.29
199 0.31
200 0.3
201 0.34
202 0.34
203 0.34
204 0.33
205 0.39
206 0.34
207 0.31
208 0.3
209 0.26
210 0.27
211 0.26
212 0.24
213 0.17
214 0.16
215 0.15
216 0.15
217 0.14
218 0.1
219 0.09
220 0.08
221 0.08
222 0.07
223 0.07
224 0.07
225 0.07
226 0.08
227 0.08
228 0.1
229 0.11
230 0.14
231 0.16
232 0.18
233 0.17
234 0.18
235 0.17
236 0.16
237 0.14
238 0.11
239 0.09
240 0.07
241 0.08
242 0.07
243 0.09
244 0.1
245 0.12
246 0.18
247 0.21
248 0.25
249 0.32
250 0.41
251 0.46
252 0.48
253 0.48
254 0.46
255 0.45
256 0.41
257 0.37
258 0.29
259 0.26
260 0.26
261 0.25
262 0.23
263 0.23
264 0.26
265 0.24
266 0.26
267 0.27
268 0.25
269 0.26
270 0.27
271 0.29
272 0.28
273 0.28
274 0.29
275 0.29
276 0.33
277 0.32
278 0.33
279 0.31
280 0.31
281 0.31
282 0.33
283 0.3
284 0.26
285 0.28
286 0.26
287 0.26
288 0.25
289 0.23
290 0.2
291 0.19
292 0.18
293 0.16
294 0.14
295 0.18
296 0.21
297 0.24
298 0.24
299 0.24
300 0.24
301 0.24
302 0.23
303 0.19
304 0.18
305 0.17
306 0.16
307 0.15
308 0.15
309 0.16
310 0.19
311 0.22
312 0.27
313 0.33
314 0.36
315 0.4
316 0.4
317 0.39
318 0.4
319 0.4
320 0.37
321 0.38
322 0.38
323 0.35
324 0.38
325 0.4
326 0.38
327 0.35
328 0.34
329 0.33
330 0.33
331 0.31
332 0.28
333 0.26
334 0.28
335 0.26
336 0.21
337 0.14
338 0.11
339 0.11
340 0.11
341 0.1
342 0.06
343 0.06
344 0.07
345 0.07
346 0.06
347 0.07
348 0.08
349 0.11
350 0.11
351 0.1
352 0.11
353 0.13
354 0.12
355 0.12
356 0.1
357 0.09
358 0.09
359 0.1
360 0.1
361 0.09
362 0.11
363 0.15
364 0.17
365 0.21
366 0.24
367 0.27
368 0.35
369 0.37
370 0.39
371 0.38
372 0.38
373 0.33
374 0.32
375 0.3
376 0.22
377 0.2
378 0.17
379 0.15
380 0.14
381 0.15
382 0.14
383 0.16
384 0.17
385 0.19
386 0.2
387 0.21
388 0.24
389 0.26
390 0.3
391 0.28
392 0.34
393 0.37
394 0.36
395 0.36
396 0.34
397 0.35
398 0.35
399 0.35
400 0.27
401 0.29
402 0.29
403 0.28
404 0.26
405 0.22
406 0.17
407 0.16
408 0.17
409 0.14
410 0.15
411 0.15
412 0.17
413 0.18
414 0.22
415 0.27