Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5GY71

Protein Details
Accession C5GY71    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
32-51NSSVEKRRRNKEERERREAQBasic
NLS Segment(s)
PositionSequence
37-71KRRRNKEERERREAQVKAAKEKADAAVRAQPRPFK
Subcellular Location(s) nucl 13, cyto_nucl 11.5, cyto 8, mito 6
Family & Domain DBs
Amino Acid Sequences MSGIDPNTRREVNKAIIDSGAAIVGQMVAAANSSVEKRRRNKEERERREAQVKAAKEKADAAVRAQPRPFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.34
3 0.31
4 0.3
5 0.26
6 0.2
7 0.14
8 0.07
9 0.05
10 0.04
11 0.04
12 0.03
13 0.03
14 0.02
15 0.02
16 0.02
17 0.02
18 0.02
19 0.03
20 0.04
21 0.09
22 0.14
23 0.21
24 0.28
25 0.37
26 0.46
27 0.53
28 0.63
29 0.69
30 0.76
31 0.79
32 0.81
33 0.77
34 0.72
35 0.73
36 0.63
37 0.6
38 0.55
39 0.5
40 0.48
41 0.47
42 0.44
43 0.37
44 0.38
45 0.35
46 0.34
47 0.32
48 0.28
49 0.32
50 0.35
51 0.39