Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094CLG8

Protein Details
Accession A0A094CLG8    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
426-453WRNSNQDPRLRSRRVRRMAKINSRKLVHHydrophilic
NLS Segment(s)
PositionSequence
436-445RSRRVRRMAK
Subcellular Location(s) nucl 13, mito 12.5, cyto_mito 7.5
Family & Domain DBs
Amino Acid Sequences PTPPRTLSRYLPLSASSSPITHQTPSARAKVPCPVDNTLPPIATATSRTRAHYRIKKIVDASFSQHALSARLAPSPASARREAYTTVNAASAAPRAGPAAATTAAPAPLQRRASAAAATRPSAAATAFRTPSATGTYTSAAADTPDIIAAAGMARPLYPPIYHTPQSNSPASVASPSGHDQHGRQIYSQPPSQMQQQQPMYYPPPPQPYPPMPQQGNPSPYGQQQPQHHQGMGPQSNLLMSHPQAQHQMQHPGQHPQQMTSSPRVTKMEHPPQQQQQRTAAAPPQGQPQPPHTLQHIPPATNGAPPLPGTGVNPSAAPGPIPATTPLVVRQDGNGVQWIAFEYSRDRVKMEYTIRCDVESVAVDSLAPEFKTENCVYPRACCSKDQYRGNRLVYESECNTVGWALAELNPCLRGKRGLIQRAVDSWRNSNQDPRLRSRRVRRMAKINSRKLVHAAPLGLPPGAPPGPLPVQQQQQQQQGKMGAQMHHHHQAHADGAAAPNGDDGSGMFHQM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.34
3 0.27
4 0.22
5 0.22
6 0.25
7 0.26
8 0.23
9 0.27
10 0.28
11 0.34
12 0.39
13 0.45
14 0.46
15 0.46
16 0.48
17 0.52
18 0.54
19 0.51
20 0.51
21 0.48
22 0.47
23 0.49
24 0.51
25 0.46
26 0.39
27 0.34
28 0.3
29 0.27
30 0.22
31 0.23
32 0.23
33 0.27
34 0.29
35 0.33
36 0.37
37 0.43
38 0.52
39 0.57
40 0.61
41 0.63
42 0.65
43 0.67
44 0.66
45 0.65
46 0.59
47 0.53
48 0.48
49 0.43
50 0.4
51 0.33
52 0.31
53 0.27
54 0.24
55 0.22
56 0.21
57 0.17
58 0.18
59 0.18
60 0.16
61 0.18
62 0.23
63 0.27
64 0.27
65 0.29
66 0.3
67 0.31
68 0.33
69 0.33
70 0.31
71 0.29
72 0.26
73 0.24
74 0.22
75 0.21
76 0.19
77 0.18
78 0.15
79 0.11
80 0.09
81 0.09
82 0.09
83 0.08
84 0.08
85 0.08
86 0.09
87 0.09
88 0.09
89 0.1
90 0.1
91 0.11
92 0.11
93 0.12
94 0.12
95 0.18
96 0.2
97 0.2
98 0.2
99 0.22
100 0.24
101 0.26
102 0.26
103 0.26
104 0.26
105 0.27
106 0.25
107 0.23
108 0.21
109 0.18
110 0.15
111 0.12
112 0.13
113 0.17
114 0.18
115 0.18
116 0.19
117 0.18
118 0.19
119 0.2
120 0.18
121 0.14
122 0.16
123 0.17
124 0.16
125 0.16
126 0.14
127 0.11
128 0.1
129 0.09
130 0.07
131 0.06
132 0.05
133 0.05
134 0.05
135 0.05
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.06
144 0.07
145 0.07
146 0.1
147 0.16
148 0.23
149 0.24
150 0.26
151 0.3
152 0.35
153 0.39
154 0.38
155 0.32
156 0.26
157 0.25
158 0.24
159 0.2
160 0.15
161 0.11
162 0.11
163 0.12
164 0.14
165 0.14
166 0.15
167 0.15
168 0.22
169 0.26
170 0.25
171 0.24
172 0.26
173 0.3
174 0.33
175 0.35
176 0.28
177 0.25
178 0.26
179 0.32
180 0.35
181 0.32
182 0.36
183 0.37
184 0.36
185 0.36
186 0.37
187 0.34
188 0.29
189 0.3
190 0.27
191 0.31
192 0.31
193 0.32
194 0.35
195 0.37
196 0.39
197 0.42
198 0.44
199 0.39
200 0.41
201 0.45
202 0.44
203 0.43
204 0.39
205 0.35
206 0.29
207 0.3
208 0.31
209 0.28
210 0.27
211 0.29
212 0.34
213 0.39
214 0.4
215 0.37
216 0.33
217 0.33
218 0.37
219 0.34
220 0.27
221 0.2
222 0.18
223 0.18
224 0.18
225 0.16
226 0.09
227 0.07
228 0.14
229 0.14
230 0.16
231 0.19
232 0.19
233 0.22
234 0.24
235 0.3
236 0.24
237 0.29
238 0.29
239 0.32
240 0.33
241 0.34
242 0.31
243 0.26
244 0.26
245 0.24
246 0.25
247 0.24
248 0.26
249 0.22
250 0.24
251 0.25
252 0.26
253 0.29
254 0.37
255 0.42
256 0.45
257 0.48
258 0.52
259 0.58
260 0.64
261 0.61
262 0.54
263 0.48
264 0.44
265 0.41
266 0.36
267 0.32
268 0.27
269 0.26
270 0.24
271 0.26
272 0.25
273 0.26
274 0.26
275 0.27
276 0.3
277 0.3
278 0.3
279 0.27
280 0.3
281 0.29
282 0.37
283 0.35
284 0.28
285 0.27
286 0.3
287 0.28
288 0.23
289 0.22
290 0.13
291 0.12
292 0.12
293 0.12
294 0.09
295 0.08
296 0.08
297 0.1
298 0.11
299 0.1
300 0.1
301 0.1
302 0.1
303 0.1
304 0.09
305 0.07
306 0.08
307 0.08
308 0.09
309 0.09
310 0.1
311 0.11
312 0.12
313 0.15
314 0.15
315 0.16
316 0.15
317 0.14
318 0.16
319 0.16
320 0.16
321 0.15
322 0.13
323 0.12
324 0.12
325 0.12
326 0.1
327 0.09
328 0.09
329 0.09
330 0.14
331 0.16
332 0.17
333 0.17
334 0.16
335 0.19
336 0.25
337 0.29
338 0.32
339 0.35
340 0.39
341 0.39
342 0.38
343 0.37
344 0.3
345 0.26
346 0.2
347 0.16
348 0.11
349 0.1
350 0.1
351 0.09
352 0.1
353 0.09
354 0.08
355 0.07
356 0.07
357 0.08
358 0.14
359 0.15
360 0.2
361 0.22
362 0.26
363 0.26
364 0.29
365 0.36
366 0.36
367 0.37
368 0.34
369 0.39
370 0.45
371 0.53
372 0.59
373 0.61
374 0.63
375 0.69
376 0.69
377 0.65
378 0.57
379 0.53
380 0.45
381 0.42
382 0.35
383 0.3
384 0.28
385 0.24
386 0.23
387 0.17
388 0.15
389 0.09
390 0.08
391 0.07
392 0.1
393 0.11
394 0.12
395 0.12
396 0.15
397 0.15
398 0.16
399 0.17
400 0.17
401 0.18
402 0.27
403 0.35
404 0.4
405 0.45
406 0.47
407 0.47
408 0.49
409 0.52
410 0.49
411 0.42
412 0.4
413 0.41
414 0.43
415 0.42
416 0.45
417 0.49
418 0.51
419 0.54
420 0.59
421 0.62
422 0.65
423 0.73
424 0.76
425 0.78
426 0.81
427 0.85
428 0.84
429 0.85
430 0.88
431 0.9
432 0.89
433 0.88
434 0.86
435 0.78
436 0.72
437 0.65
438 0.58
439 0.52
440 0.45
441 0.37
442 0.31
443 0.31
444 0.3
445 0.26
446 0.21
447 0.17
448 0.19
449 0.17
450 0.15
451 0.12
452 0.17
453 0.21
454 0.25
455 0.3
456 0.31
457 0.38
458 0.44
459 0.52
460 0.54
461 0.6
462 0.62
463 0.59
464 0.58
465 0.54
466 0.49
467 0.46
468 0.44
469 0.38
470 0.38
471 0.41
472 0.42
473 0.48
474 0.48
475 0.43
476 0.4
477 0.39
478 0.35
479 0.3
480 0.25
481 0.17
482 0.17
483 0.18
484 0.16
485 0.13
486 0.12
487 0.11
488 0.1
489 0.08
490 0.07
491 0.11