Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179U512

Protein Details
Accession A0A179U512    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
12-36INPIAQCGKKKKKTGSYRNLSPRTRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, mito_nucl 13.333, cyto_mito 12.333
Family & Domain DBs
Amino Acid Sequences MFNSPLCLLSHINPIAQCGKKKKKTGSYRNLSPRTRFLFGAGLMAYATVGMWWSPKIEEALGMVPSSEEQAELDRKLSVKISSVER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.33
4 0.37
5 0.39
6 0.49
7 0.56
8 0.64
9 0.7
10 0.73
11 0.8
12 0.84
13 0.85
14 0.83
15 0.84
16 0.86
17 0.86
18 0.79
19 0.71
20 0.67
21 0.61
22 0.55
23 0.45
24 0.36
25 0.3
26 0.26
27 0.25
28 0.17
29 0.12
30 0.1
31 0.09
32 0.07
33 0.04
34 0.04
35 0.02
36 0.02
37 0.02
38 0.03
39 0.03
40 0.04
41 0.05
42 0.06
43 0.07
44 0.07
45 0.07
46 0.08
47 0.1
48 0.1
49 0.1
50 0.09
51 0.08
52 0.08
53 0.09
54 0.07
55 0.05
56 0.05
57 0.1
58 0.13
59 0.14
60 0.15
61 0.16
62 0.16
63 0.18
64 0.2
65 0.18
66 0.19