Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q75BX4

Protein Details
Accession Q75BX4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
28-57SAAPHFLHLQKKKYRKQRRTLRRYFADDSFHydrophilic
NLS Segment(s)
PositionSequence
38-46KKKYRKQRR
Subcellular Location(s) mito 17, cyto 4, pero 4, cyto_pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019012  RNA_cap_Gua-N2-MeTrfase  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0071164  F:RNA trimethylguanosine synthase activity  
GO:0036261  P:7-methylguanosine cap hypermethylation  
GO:0009452  P:7-methylguanosine RNA capping  
KEGG ago:AGOS_ACR147C  -  
Pfam View protein in Pfam  
PF09445  Methyltransf_15  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MAKHVEYSGRLRLHKFLSEPAELMAFKSAAPHFLHLQKKKYRKQRRTLRRYFADDSFRYLPRDNAPKKSIAKYWSYRHDLFSLIDQGNIHLTEELWYSVTPERVAKFTAAFIEACLPGATTILDVFCGGGGNVVHFAKVFQKVYGVELKLEHLYCTYRNAEAYGVADRVWLKHGDWLQLAARGRFERVHVDCVFASPPWGGIDYTKTQAYDLETQLQPAGLSQLLSSFLRISANVVLFLPKNSNLQQLSEITRSLLGPEAKCKVLYARENGRDKGLLCFWGEAFYNFDAASPANSGERLAARLQEAHDLYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.44
3 0.43
4 0.42
5 0.41
6 0.39
7 0.34
8 0.33
9 0.27
10 0.26
11 0.21
12 0.15
13 0.13
14 0.17
15 0.17
16 0.18
17 0.2
18 0.22
19 0.24
20 0.32
21 0.42
22 0.43
23 0.52
24 0.57
25 0.66
26 0.72
27 0.79
28 0.83
29 0.83
30 0.88
31 0.9
32 0.92
33 0.93
34 0.94
35 0.93
36 0.9
37 0.87
38 0.82
39 0.77
40 0.75
41 0.64
42 0.61
43 0.55
44 0.48
45 0.44
46 0.4
47 0.37
48 0.35
49 0.45
50 0.43
51 0.47
52 0.47
53 0.51
54 0.55
55 0.56
56 0.54
57 0.48
58 0.51
59 0.5
60 0.55
61 0.57
62 0.59
63 0.56
64 0.53
65 0.5
66 0.43
67 0.37
68 0.33
69 0.3
70 0.23
71 0.22
72 0.19
73 0.18
74 0.18
75 0.17
76 0.14
77 0.08
78 0.08
79 0.08
80 0.09
81 0.09
82 0.08
83 0.07
84 0.09
85 0.11
86 0.12
87 0.12
88 0.14
89 0.15
90 0.15
91 0.16
92 0.15
93 0.13
94 0.13
95 0.13
96 0.12
97 0.11
98 0.1
99 0.11
100 0.1
101 0.1
102 0.09
103 0.08
104 0.07
105 0.07
106 0.07
107 0.04
108 0.05
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.03
116 0.04
117 0.04
118 0.04
119 0.06
120 0.06
121 0.06
122 0.06
123 0.07
124 0.09
125 0.13
126 0.13
127 0.11
128 0.13
129 0.13
130 0.16
131 0.19
132 0.17
133 0.14
134 0.13
135 0.15
136 0.15
137 0.14
138 0.12
139 0.09
140 0.1
141 0.1
142 0.12
143 0.12
144 0.11
145 0.11
146 0.12
147 0.11
148 0.1
149 0.11
150 0.09
151 0.08
152 0.07
153 0.08
154 0.08
155 0.08
156 0.09
157 0.09
158 0.08
159 0.12
160 0.14
161 0.15
162 0.15
163 0.16
164 0.15
165 0.19
166 0.19
167 0.16
168 0.17
169 0.15
170 0.16
171 0.15
172 0.16
173 0.19
174 0.2
175 0.26
176 0.23
177 0.25
178 0.24
179 0.24
180 0.24
181 0.16
182 0.15
183 0.09
184 0.09
185 0.08
186 0.09
187 0.08
188 0.08
189 0.12
190 0.13
191 0.15
192 0.16
193 0.15
194 0.14
195 0.16
196 0.19
197 0.19
198 0.18
199 0.22
200 0.21
201 0.21
202 0.21
203 0.2
204 0.16
205 0.12
206 0.12
207 0.06
208 0.06
209 0.06
210 0.06
211 0.09
212 0.09
213 0.09
214 0.08
215 0.09
216 0.09
217 0.09
218 0.11
219 0.12
220 0.12
221 0.12
222 0.12
223 0.14
224 0.14
225 0.15
226 0.15
227 0.13
228 0.17
229 0.18
230 0.24
231 0.23
232 0.24
233 0.26
234 0.27
235 0.3
236 0.27
237 0.26
238 0.2
239 0.2
240 0.19
241 0.17
242 0.19
243 0.19
244 0.18
245 0.23
246 0.26
247 0.26
248 0.27
249 0.26
250 0.26
251 0.3
252 0.34
253 0.37
254 0.44
255 0.52
256 0.57
257 0.58
258 0.56
259 0.51
260 0.46
261 0.43
262 0.36
263 0.29
264 0.25
265 0.25
266 0.22
267 0.22
268 0.22
269 0.17
270 0.18
271 0.16
272 0.16
273 0.14
274 0.14
275 0.13
276 0.12
277 0.13
278 0.11
279 0.11
280 0.12
281 0.12
282 0.12
283 0.14
284 0.15
285 0.16
286 0.17
287 0.18
288 0.19
289 0.22
290 0.23
291 0.27