Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094F457

Protein Details
Accession A0A094F457   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
66-91AGAACCCRKKPQRREKRYRAGQEERGHydrophilic
NLS Segment(s)
PositionSequence
74-85KKPQRREKRYRA
Subcellular Location(s) extr 14, mito 5, plas 4, nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MHFPLLTIASLSLFLAAAAATPLTSPNTPAADGPTFDSSTPPKPRMVAGLQGGMAVAGAAAGAGAAGAACCCRKKPQRREKRYRAGQEERGCGAQRRRKAEEERDVEGAEVEQGRGGAEDGFRPAQVGEQIIEMPETPPPSYAKLARPEGEGIELEARPVGKGEVSKEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.05
10 0.08
11 0.09
12 0.1
13 0.13
14 0.15
15 0.16
16 0.16
17 0.2
18 0.18
19 0.19
20 0.21
21 0.2
22 0.2
23 0.19
24 0.21
25 0.2
26 0.27
27 0.33
28 0.31
29 0.3
30 0.3
31 0.31
32 0.33
33 0.33
34 0.3
35 0.25
36 0.25
37 0.23
38 0.22
39 0.21
40 0.15
41 0.12
42 0.06
43 0.04
44 0.02
45 0.02
46 0.01
47 0.01
48 0.01
49 0.01
50 0.01
51 0.01
52 0.01
53 0.01
54 0.02
55 0.03
56 0.04
57 0.05
58 0.06
59 0.14
60 0.24
61 0.35
62 0.46
63 0.57
64 0.68
65 0.78
66 0.88
67 0.91
68 0.92
69 0.91
70 0.88
71 0.86
72 0.81
73 0.78
74 0.72
75 0.64
76 0.54
77 0.47
78 0.39
79 0.34
80 0.35
81 0.33
82 0.34
83 0.38
84 0.41
85 0.46
86 0.52
87 0.57
88 0.59
89 0.58
90 0.55
91 0.5
92 0.45
93 0.39
94 0.32
95 0.23
96 0.14
97 0.1
98 0.07
99 0.05
100 0.05
101 0.05
102 0.05
103 0.06
104 0.05
105 0.05
106 0.06
107 0.09
108 0.09
109 0.09
110 0.09
111 0.09
112 0.1
113 0.11
114 0.11
115 0.09
116 0.09
117 0.1
118 0.09
119 0.1
120 0.08
121 0.08
122 0.09
123 0.11
124 0.1
125 0.12
126 0.14
127 0.17
128 0.21
129 0.25
130 0.3
131 0.36
132 0.41
133 0.41
134 0.42
135 0.4
136 0.37
137 0.34
138 0.28
139 0.22
140 0.21
141 0.19
142 0.16
143 0.16
144 0.15
145 0.13
146 0.13
147 0.12
148 0.11
149 0.14