Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094CCP7

Protein Details
Accession A0A094CCP7   
Localization Confidence Low
Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
295-317GSMFGQQQPPKKQPKRVGATSSAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12.5, nucl 11, cyto 10, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007317  GET4  
IPR011990  TPR-like_helical_dom_sf  
Gene Ontology GO:0045048  P:protein insertion into ER membrane  
Pfam View protein in Pfam  
PF04190  GET4  
Amino Acid Sequences MSSKIEKIITRLQSKITEGQFYEAQQQTRVVASRYIKAKDWPAAIDILYNVASSLLKAEQGGSGGDLSIFLVDVYKQAELVPDAANKGKLLTLLRLFDSEEPTRKKFINEIIGWSAKFGSYPAGEPELHHVTGSLYAAEYDVYDAERHLLLGTKDSPPLLANLEYDWYATDDSHTAATYAARAVLPYLLLGNVRDASTTLQLFTARLASSNPSLAVQSSKSGTKVYPSLPLLNFLTLLVLSVEKGAADLFRQLKSHYASHIKEAVGWDEALESIAEMYFGISRPRQGNPLFDMMGSMFGQQQPPKKQPKRVGATSSAPAAEGLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.5
3 0.44
4 0.41
5 0.37
6 0.39
7 0.37
8 0.34
9 0.39
10 0.36
11 0.34
12 0.3
13 0.3
14 0.27
15 0.28
16 0.29
17 0.22
18 0.24
19 0.26
20 0.31
21 0.36
22 0.38
23 0.37
24 0.4
25 0.44
26 0.43
27 0.43
28 0.37
29 0.33
30 0.32
31 0.29
32 0.25
33 0.19
34 0.15
35 0.13
36 0.11
37 0.09
38 0.08
39 0.08
40 0.07
41 0.09
42 0.07
43 0.08
44 0.08
45 0.09
46 0.09
47 0.09
48 0.1
49 0.08
50 0.08
51 0.07
52 0.07
53 0.06
54 0.06
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.05
61 0.07
62 0.07
63 0.07
64 0.07
65 0.08
66 0.09
67 0.1
68 0.11
69 0.11
70 0.13
71 0.14
72 0.15
73 0.14
74 0.14
75 0.12
76 0.13
77 0.13
78 0.16
79 0.18
80 0.19
81 0.19
82 0.19
83 0.2
84 0.19
85 0.23
86 0.22
87 0.26
88 0.3
89 0.31
90 0.33
91 0.33
92 0.33
93 0.31
94 0.34
95 0.36
96 0.32
97 0.34
98 0.35
99 0.36
100 0.35
101 0.31
102 0.25
103 0.16
104 0.15
105 0.11
106 0.09
107 0.08
108 0.09
109 0.1
110 0.13
111 0.13
112 0.13
113 0.19
114 0.19
115 0.19
116 0.18
117 0.16
118 0.13
119 0.14
120 0.14
121 0.09
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.04
128 0.04
129 0.04
130 0.05
131 0.04
132 0.05
133 0.05
134 0.05
135 0.05
136 0.07
137 0.07
138 0.09
139 0.11
140 0.11
141 0.12
142 0.11
143 0.12
144 0.1
145 0.11
146 0.1
147 0.09
148 0.08
149 0.08
150 0.08
151 0.08
152 0.08
153 0.07
154 0.06
155 0.06
156 0.06
157 0.06
158 0.06
159 0.06
160 0.07
161 0.06
162 0.06
163 0.06
164 0.06
165 0.06
166 0.05
167 0.06
168 0.05
169 0.05
170 0.05
171 0.05
172 0.05
173 0.04
174 0.05
175 0.04
176 0.05
177 0.05
178 0.06
179 0.06
180 0.06
181 0.06
182 0.07
183 0.08
184 0.1
185 0.1
186 0.09
187 0.09
188 0.1
189 0.1
190 0.1
191 0.1
192 0.08
193 0.08
194 0.09
195 0.1
196 0.11
197 0.12
198 0.12
199 0.1
200 0.1
201 0.1
202 0.11
203 0.1
204 0.11
205 0.12
206 0.13
207 0.13
208 0.14
209 0.14
210 0.15
211 0.18
212 0.18
213 0.22
214 0.23
215 0.28
216 0.27
217 0.3
218 0.28
219 0.25
220 0.23
221 0.17
222 0.15
223 0.09
224 0.09
225 0.07
226 0.06
227 0.05
228 0.05
229 0.05
230 0.04
231 0.05
232 0.05
233 0.04
234 0.05
235 0.11
236 0.13
237 0.15
238 0.16
239 0.16
240 0.22
241 0.25
242 0.27
243 0.27
244 0.33
245 0.33
246 0.37
247 0.41
248 0.36
249 0.34
250 0.34
251 0.29
252 0.22
253 0.21
254 0.16
255 0.12
256 0.12
257 0.1
258 0.08
259 0.06
260 0.05
261 0.05
262 0.05
263 0.04
264 0.05
265 0.06
266 0.07
267 0.11
268 0.12
269 0.17
270 0.2
271 0.23
272 0.29
273 0.3
274 0.35
275 0.35
276 0.4
277 0.35
278 0.32
279 0.31
280 0.24
281 0.25
282 0.2
283 0.16
284 0.13
285 0.14
286 0.19
287 0.22
288 0.3
289 0.36
290 0.45
291 0.55
292 0.62
293 0.7
294 0.75
295 0.82
296 0.83
297 0.83
298 0.81
299 0.77
300 0.74
301 0.67
302 0.61
303 0.5
304 0.41