Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179U2B7

Protein Details
Accession A0A179U2B7    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
50-77FDQVLKRGKVLRRSKNKHAFKSSWKPGYHydrophilic
NLS Segment(s)
PositionSequence
56-67RGKVLRRSKNKH
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011993  PH-like_dom_sf  
IPR001849  PH_domain  
Gene Ontology GO:0016757  F:glycosyltransferase activity  
Pfam View protein in Pfam  
PF00169  PH  
PROSITE View protein in PROSITE  
PS50003  PH_DOMAIN  
CDD cd13298  PH1_PH_fungal  
cd13299  PH2_PH_fungal  
Amino Acid Sequences MALRIDSQIENPAQSVTGGTTQTQRGFSSRHGHLNLDTFSPVNENGSFAFDQVLKRGKVLRRSKNKHAFKSSWKPGYLVLRPNLLSLYKDAEEAELQVSIDLSDVTAVASLKATKSKRQHIFGIFSPSNNYRFQATSEADAESWVERIRNESYSDDAGSLEGYDIAENKKPGEAAAESASETDCDGRRASQHDAPSIRSGNRQARQQLSHTTTHDYSGNEIASCSDFSDAVASATPHRSTASLPPHDGPSLSPSAPLDRRPSLPRDTAQLADGALGNLAPERVICHGYLLCLKSKKGVRQWKKLWVVLRPHNICFYKDQQEYAATKIISMLQVINAAEIDPISRSKKFCLQVIAEDKTYRFCAPDEEALAKWLGALKSLLVRRHGSTSKHAAGPAVAGLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.11
4 0.14
5 0.14
6 0.15
7 0.19
8 0.23
9 0.27
10 0.28
11 0.27
12 0.27
13 0.29
14 0.33
15 0.37
16 0.38
17 0.43
18 0.43
19 0.44
20 0.44
21 0.47
22 0.43
23 0.36
24 0.32
25 0.24
26 0.22
27 0.22
28 0.19
29 0.16
30 0.15
31 0.14
32 0.14
33 0.18
34 0.18
35 0.15
36 0.17
37 0.16
38 0.17
39 0.21
40 0.27
41 0.23
42 0.25
43 0.33
44 0.36
45 0.44
46 0.54
47 0.59
48 0.64
49 0.72
50 0.81
51 0.84
52 0.88
53 0.87
54 0.86
55 0.83
56 0.82
57 0.84
58 0.83
59 0.8
60 0.71
61 0.62
62 0.58
63 0.6
64 0.56
65 0.52
66 0.45
67 0.42
68 0.41
69 0.41
70 0.38
71 0.29
72 0.24
73 0.18
74 0.21
75 0.16
76 0.16
77 0.16
78 0.16
79 0.15
80 0.15
81 0.14
82 0.09
83 0.09
84 0.08
85 0.08
86 0.06
87 0.06
88 0.05
89 0.04
90 0.04
91 0.04
92 0.04
93 0.05
94 0.05
95 0.05
96 0.06
97 0.07
98 0.08
99 0.15
100 0.17
101 0.24
102 0.32
103 0.42
104 0.48
105 0.52
106 0.58
107 0.56
108 0.59
109 0.54
110 0.56
111 0.46
112 0.4
113 0.39
114 0.35
115 0.33
116 0.29
117 0.26
118 0.19
119 0.19
120 0.21
121 0.23
122 0.21
123 0.21
124 0.21
125 0.21
126 0.18
127 0.18
128 0.17
129 0.11
130 0.1
131 0.08
132 0.08
133 0.07
134 0.1
135 0.12
136 0.14
137 0.15
138 0.16
139 0.18
140 0.18
141 0.19
142 0.16
143 0.14
144 0.12
145 0.1
146 0.09
147 0.06
148 0.05
149 0.04
150 0.04
151 0.05
152 0.07
153 0.09
154 0.09
155 0.1
156 0.1
157 0.1
158 0.1
159 0.11
160 0.1
161 0.1
162 0.11
163 0.11
164 0.11
165 0.11
166 0.11
167 0.08
168 0.08
169 0.08
170 0.07
171 0.08
172 0.08
173 0.09
174 0.11
175 0.14
176 0.18
177 0.2
178 0.22
179 0.25
180 0.26
181 0.27
182 0.28
183 0.27
184 0.24
185 0.22
186 0.27
187 0.3
188 0.32
189 0.35
190 0.36
191 0.38
192 0.39
193 0.39
194 0.4
195 0.36
196 0.36
197 0.33
198 0.33
199 0.29
200 0.28
201 0.27
202 0.21
203 0.18
204 0.17
205 0.16
206 0.12
207 0.11
208 0.11
209 0.09
210 0.09
211 0.08
212 0.06
213 0.06
214 0.06
215 0.07
216 0.06
217 0.06
218 0.06
219 0.06
220 0.08
221 0.1
222 0.1
223 0.09
224 0.1
225 0.1
226 0.11
227 0.19
228 0.25
229 0.26
230 0.28
231 0.29
232 0.3
233 0.3
234 0.28
235 0.21
236 0.17
237 0.17
238 0.15
239 0.15
240 0.14
241 0.19
242 0.21
243 0.23
244 0.25
245 0.24
246 0.28
247 0.31
248 0.36
249 0.35
250 0.38
251 0.36
252 0.35
253 0.35
254 0.32
255 0.29
256 0.24
257 0.19
258 0.16
259 0.15
260 0.09
261 0.07
262 0.05
263 0.05
264 0.04
265 0.04
266 0.04
267 0.03
268 0.05
269 0.07
270 0.08
271 0.08
272 0.1
273 0.11
274 0.12
275 0.17
276 0.18
277 0.21
278 0.23
279 0.23
280 0.28
281 0.34
282 0.4
283 0.45
284 0.55
285 0.59
286 0.67
287 0.74
288 0.77
289 0.78
290 0.75
291 0.7
292 0.66
293 0.66
294 0.64
295 0.67
296 0.61
297 0.56
298 0.59
299 0.56
300 0.5
301 0.46
302 0.44
303 0.43
304 0.4
305 0.4
306 0.34
307 0.38
308 0.38
309 0.35
310 0.34
311 0.24
312 0.23
313 0.23
314 0.22
315 0.17
316 0.16
317 0.14
318 0.1
319 0.12
320 0.12
321 0.12
322 0.1
323 0.09
324 0.08
325 0.08
326 0.08
327 0.07
328 0.1
329 0.14
330 0.18
331 0.2
332 0.24
333 0.33
334 0.36
335 0.39
336 0.43
337 0.42
338 0.48
339 0.54
340 0.54
341 0.48
342 0.46
343 0.43
344 0.38
345 0.38
346 0.29
347 0.23
348 0.19
349 0.22
350 0.25
351 0.3
352 0.3
353 0.3
354 0.3
355 0.3
356 0.3
357 0.24
358 0.19
359 0.19
360 0.15
361 0.14
362 0.14
363 0.14
364 0.21
365 0.26
366 0.3
367 0.3
368 0.33
369 0.35
370 0.43
371 0.47
372 0.44
373 0.47
374 0.53
375 0.54
376 0.54
377 0.52
378 0.44
379 0.39
380 0.36