Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094D521

Protein Details
Accession A0A094D521    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
64-83SDNSKVLKGKCQNKNGKLTCHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 27
Family & Domain DBs
Amino Acid Sequences MLFKTSFISAIALLAANQVIGAAVELPRGEAGILIATDPYYACNCPNNCSYKPGTGCRFYSGPSDNSKVLKGKCQNKNGKLTCIPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.05
4 0.05
5 0.04
6 0.03
7 0.03
8 0.03
9 0.03
10 0.04
11 0.04
12 0.04
13 0.05
14 0.05
15 0.05
16 0.05
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.05
27 0.05
28 0.06
29 0.07
30 0.13
31 0.13
32 0.16
33 0.2
34 0.25
35 0.25
36 0.29
37 0.3
38 0.31
39 0.34
40 0.38
41 0.39
42 0.38
43 0.38
44 0.38
45 0.36
46 0.31
47 0.33
48 0.3
49 0.29
50 0.29
51 0.32
52 0.3
53 0.31
54 0.33
55 0.34
56 0.32
57 0.38
58 0.42
59 0.49
60 0.55
61 0.64
62 0.71
63 0.73
64 0.82
65 0.78
66 0.77