Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094DIW7

Protein Details
Accession A0A094DIW7    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
54-89CGKQCKHNSTKMRAKWRKKRTRRLKRKRRKTRARSKBasic
NLS Segment(s)
PositionSequence
64-89KMRAKWRKKRTRRLKRKRRKTRARSK
Subcellular Location(s) mito 17, nucl 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MAGLGSMLPLPCLSGTLGDATDWVKRLNNHRSIETAKIYEGALAIHGHWWSGHCGKQCKHNSTKMRAKWRKKRTRRLKRKRRKTRARSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.09
5 0.08
6 0.09
7 0.09
8 0.11
9 0.11
10 0.11
11 0.13
12 0.16
13 0.25
14 0.33
15 0.4
16 0.41
17 0.41
18 0.44
19 0.44
20 0.45
21 0.39
22 0.3
23 0.22
24 0.21
25 0.19
26 0.15
27 0.12
28 0.08
29 0.07
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.05
36 0.06
37 0.09
38 0.11
39 0.14
40 0.18
41 0.25
42 0.26
43 0.36
44 0.44
45 0.48
46 0.52
47 0.58
48 0.62
49 0.65
50 0.74
51 0.72
52 0.75
53 0.78
54 0.83
55 0.84
56 0.87
57 0.89
58 0.9
59 0.94
60 0.94
61 0.95
62 0.96
63 0.96
64 0.97
65 0.97
66 0.97
67 0.98
68 0.98
69 0.97