Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4MY29

Protein Details
Accession G4MY29    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
53-80MVKFSSNKKPKPCSKHHQQQHAKPNEKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
KEGG mgr:MGG_15518  -  
Amino Acid Sequences MSGTRVTSELAEQEKYGLSPQNTPCRCLIRVKEGCEGRKLVLVQTRMPLNRSMVKFSSNKKPKPCSKHHQQQHAKPNEKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.17
4 0.18
5 0.16
6 0.22
7 0.29
8 0.38
9 0.38
10 0.4
11 0.41
12 0.41
13 0.41
14 0.41
15 0.39
16 0.39
17 0.44
18 0.45
19 0.49
20 0.49
21 0.49
22 0.44
23 0.42
24 0.31
25 0.29
26 0.25
27 0.2
28 0.2
29 0.2
30 0.19
31 0.2
32 0.23
33 0.21
34 0.22
35 0.21
36 0.2
37 0.25
38 0.26
39 0.28
40 0.25
41 0.29
42 0.32
43 0.36
44 0.44
45 0.47
46 0.52
47 0.56
48 0.65
49 0.7
50 0.75
51 0.8
52 0.78
53 0.8
54 0.84
55 0.85
56 0.87
57 0.87
58 0.88
59 0.89
60 0.9