Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4NDB9

Protein Details
Accession G4NDB9    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
12-40LPREHQTSRLPKKDKRRKKGKVVLRRGACBasic
NLS Segment(s)
PositionSequence
20-35RLPKKDKRRKKGKVVL
Subcellular Location(s) mito 21, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG mgr:MGG_17488  -  
Amino Acid Sequences MLRGRAARCLGLPREHQTSRLPKKDKRRKKGKVVLRRGACSPPLALVLKGFCMNFYLIYHLKHSEGGYGGSTTGWG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.44
3 0.44
4 0.45
5 0.51
6 0.55
7 0.6
8 0.61
9 0.6
10 0.71
11 0.8
12 0.83
13 0.83
14 0.84
15 0.84
16 0.88
17 0.91
18 0.9
19 0.89
20 0.89
21 0.86
22 0.79
23 0.72
24 0.63
25 0.55
26 0.45
27 0.35
28 0.25
29 0.17
30 0.16
31 0.15
32 0.12
33 0.11
34 0.11
35 0.11
36 0.12
37 0.11
38 0.09
39 0.09
40 0.1
41 0.1
42 0.1
43 0.14
44 0.15
45 0.17
46 0.19
47 0.19
48 0.2
49 0.21
50 0.21
51 0.18
52 0.17
53 0.17
54 0.16
55 0.15
56 0.14