Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4N397

Protein Details
Accession G4N397   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
140-166TRFYTGFKKKIKNKLVKKKRPDILAKYHydrophilic
NLS Segment(s)
PositionSequence
147-160KKKIKNKLVKKKRP
Subcellular Location(s) mito 22, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032567  LDOC1-rel  
IPR005162  Retrotrans_gag_dom  
KEGG mgr:MGG_16984  -  
Pfam View protein in Pfam  
PF03732  Retrotrans_gag  
Amino Acid Sequences TPFTTNVPANVNVLRILQKFFIKTRAYFYFNEDNFDNDANKITYAASFLKGDAFAWFEPTLRNYLDYNKEKNRKIKINRIFDNYNNFEKYFRGIFGNPNEKRTVKRKLMGFTQTKSVFKYTSKFRQITAKLLWGKKALITRFYTGFKKKIKNKLVKKKRPDILAKYMELTDANINTPNRLANIIPRFATDFRDKAEKPRGFNTTNHN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.21
3 0.23
4 0.23
5 0.26
6 0.28
7 0.3
8 0.36
9 0.34
10 0.34
11 0.39
12 0.41
13 0.42
14 0.39
15 0.44
16 0.46
17 0.42
18 0.44
19 0.38
20 0.34
21 0.32
22 0.33
23 0.27
24 0.17
25 0.19
26 0.16
27 0.16
28 0.13
29 0.12
30 0.1
31 0.12
32 0.13
33 0.13
34 0.12
35 0.12
36 0.13
37 0.13
38 0.13
39 0.11
40 0.12
41 0.1
42 0.13
43 0.13
44 0.12
45 0.13
46 0.14
47 0.16
48 0.13
49 0.16
50 0.13
51 0.19
52 0.28
53 0.32
54 0.37
55 0.44
56 0.52
57 0.56
58 0.62
59 0.65
60 0.66
61 0.68
62 0.72
63 0.72
64 0.74
65 0.73
66 0.72
67 0.67
68 0.6
69 0.6
70 0.54
71 0.48
72 0.4
73 0.35
74 0.3
75 0.26
76 0.26
77 0.19
78 0.15
79 0.14
80 0.13
81 0.18
82 0.23
83 0.33
84 0.31
85 0.33
86 0.34
87 0.33
88 0.35
89 0.37
90 0.4
91 0.35
92 0.39
93 0.4
94 0.41
95 0.46
96 0.5
97 0.48
98 0.4
99 0.43
100 0.4
101 0.37
102 0.35
103 0.31
104 0.25
105 0.22
106 0.26
107 0.26
108 0.33
109 0.4
110 0.39
111 0.39
112 0.46
113 0.47
114 0.48
115 0.43
116 0.41
117 0.4
118 0.4
119 0.41
120 0.33
121 0.31
122 0.29
123 0.32
124 0.26
125 0.25
126 0.27
127 0.27
128 0.29
129 0.32
130 0.36
131 0.34
132 0.4
133 0.42
134 0.49
135 0.55
136 0.62
137 0.69
138 0.73
139 0.8
140 0.84
141 0.88
142 0.89
143 0.9
144 0.9
145 0.86
146 0.84
147 0.82
148 0.79
149 0.77
150 0.73
151 0.64
152 0.56
153 0.5
154 0.42
155 0.33
156 0.27
157 0.2
158 0.15
159 0.15
160 0.18
161 0.18
162 0.18
163 0.19
164 0.18
165 0.16
166 0.17
167 0.17
168 0.21
169 0.26
170 0.28
171 0.28
172 0.28
173 0.31
174 0.3
175 0.36
176 0.33
177 0.29
178 0.3
179 0.38
180 0.38
181 0.42
182 0.52
183 0.51
184 0.5
185 0.56
186 0.59
187 0.53