Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4NBB4

Protein Details
Accession G4NBB4   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
8-29DCSSEARKPRQLQREKEKPFCPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG mgr:MGG_17422  -  
Amino Acid Sequences MLWVEVYDCSSEARKPRQLQREKEKPFCPLSDLNGADSIIRVGSNGNVSTVWSGVLNAYSAALAVLCKVWYRQSDDKRARVIDSFRDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.45
3 0.54
4 0.63
5 0.7
6 0.76
7 0.79
8 0.82
9 0.82
10 0.82
11 0.76
12 0.71
13 0.65
14 0.55
15 0.5
16 0.41
17 0.36
18 0.35
19 0.33
20 0.28
21 0.25
22 0.25
23 0.19
24 0.17
25 0.13
26 0.06
27 0.05
28 0.04
29 0.04
30 0.04
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.07
37 0.07
38 0.06
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.04
45 0.05
46 0.04
47 0.04
48 0.04
49 0.04
50 0.03
51 0.03
52 0.04
53 0.04
54 0.05
55 0.07
56 0.11
57 0.14
58 0.22
59 0.32
60 0.4
61 0.51
62 0.58
63 0.64
64 0.66
65 0.65
66 0.6
67 0.56
68 0.52