Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5GBM5

Protein Details
Accession C5GBM5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
65-84MEKLRSLREKLKQQRQHLDEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007648  ATPase_inhibitor_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0042030  F:ATPase inhibitor activity  
GO:0032780  P:negative regulation of ATP-dependent activity  
Pfam View protein in Pfam  
PF04568  IATP  
Amino Acid Sequences MLRQTARPLLRASQLPLKRLFSVAAVGMAEGDVGSPRATGKLSTSNSWSKKEAADEAMFIKQREMEKLRSLREKLKQQRQHLDELDAHIEQLTKEHGGEQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.42
3 0.44
4 0.43
5 0.38
6 0.37
7 0.33
8 0.24
9 0.22
10 0.18
11 0.15
12 0.11
13 0.1
14 0.09
15 0.08
16 0.06
17 0.04
18 0.04
19 0.03
20 0.04
21 0.04
22 0.04
23 0.04
24 0.05
25 0.06
26 0.06
27 0.08
28 0.16
29 0.18
30 0.19
31 0.23
32 0.3
33 0.32
34 0.35
35 0.34
36 0.27
37 0.27
38 0.27
39 0.24
40 0.2
41 0.17
42 0.15
43 0.15
44 0.17
45 0.18
46 0.16
47 0.15
48 0.15
49 0.15
50 0.2
51 0.22
52 0.22
53 0.29
54 0.34
55 0.39
56 0.43
57 0.46
58 0.48
59 0.53
60 0.6
61 0.62
62 0.69
63 0.72
64 0.73
65 0.8
66 0.76
67 0.76
68 0.68
69 0.62
70 0.53
71 0.48
72 0.43
73 0.32
74 0.29
75 0.21
76 0.19
77 0.15
78 0.14
79 0.13
80 0.11
81 0.11