Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4N923

Protein Details
Accession G4N923   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
56-81ARPERRPRDACQRRRPPERRLRTPELBasic
NLS Segment(s)
PositionSequence
56-76ARPERRPRDACQRRRPPERRL
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 8
Family & Domain DBs
KEGG mgr:MGG_17234  -  
Amino Acid Sequences MNEQLRQIIGSTWHGSHTPSRPVEQRSRHTGEDPQAVPLLLHTICHGHWALAAARARPERRPRDACQRRRPPERRLRTPELATSQGRKLYQSKPTHQHVLEGVPTARRSARVARAPLSKRRSWIVCAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.27
4 0.29
5 0.33
6 0.32
7 0.37
8 0.41
9 0.47
10 0.54
11 0.56
12 0.58
13 0.58
14 0.61
15 0.59
16 0.55
17 0.54
18 0.5
19 0.49
20 0.43
21 0.36
22 0.31
23 0.29
24 0.25
25 0.2
26 0.17
27 0.09
28 0.09
29 0.08
30 0.08
31 0.08
32 0.11
33 0.11
34 0.08
35 0.08
36 0.1
37 0.1
38 0.14
39 0.15
40 0.13
41 0.17
42 0.21
43 0.22
44 0.27
45 0.35
46 0.37
47 0.44
48 0.5
49 0.51
50 0.59
51 0.68
52 0.71
53 0.73
54 0.77
55 0.77
56 0.82
57 0.84
58 0.83
59 0.83
60 0.83
61 0.82
62 0.8
63 0.8
64 0.74
65 0.7
66 0.64
67 0.57
68 0.52
69 0.44
70 0.38
71 0.33
72 0.31
73 0.29
74 0.28
75 0.29
76 0.3
77 0.37
78 0.41
79 0.47
80 0.51
81 0.56
82 0.61
83 0.56
84 0.53
85 0.46
86 0.42
87 0.35
88 0.31
89 0.26
90 0.22
91 0.22
92 0.21
93 0.21
94 0.19
95 0.21
96 0.26
97 0.34
98 0.38
99 0.42
100 0.46
101 0.55
102 0.59
103 0.65
104 0.65
105 0.6
106 0.56
107 0.59
108 0.57
109 0.52