Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179U8B0

Protein Details
Accession A0A179U8B0    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
31-52VTKKSEQTKKCQTNKVKPHAAHHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10.333, nucl 9.5, cyto 9, mito_nucl 8.666, mito 6.5
Family & Domain DBs
Amino Acid Sequences MKIFRYLNDDDSAVYMWMGPKRERGQLNPTVTKKSEQTKKCQTNKVKPHAAHPTPFETGFNSDAPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.1
3 0.11
4 0.13
5 0.16
6 0.16
7 0.22
8 0.25
9 0.32
10 0.34
11 0.35
12 0.4
13 0.45
14 0.5
15 0.51
16 0.49
17 0.47
18 0.45
19 0.42
20 0.38
21 0.39
22 0.41
23 0.37
24 0.44
25 0.51
26 0.6
27 0.66
28 0.72
29 0.73
30 0.75
31 0.82
32 0.82
33 0.8
34 0.71
35 0.72
36 0.73
37 0.68
38 0.62
39 0.56
40 0.51
41 0.46
42 0.45
43 0.38
44 0.3
45 0.29
46 0.27