Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4MRK6

Protein Details
Accession G4MRK6    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
295-315GFGSRDKRKRWSVCGAERRGDBasic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
KEGG mgr:MGG_16301  -  
Amino Acid Sequences MEPVPETERMEAFRSSPLPMLRLHSLSEIAEFELPQKPPTVRRCTEPASPSSPSWTIPANLPYRPRTTSPLSGISHHTRSRSAASTLAPPMIRTQSLPGANGAGHILFSPQRSSSPSRSPIRPQQVRLPRKPADEAFPTSPTRISVFDQERRVTERNSVPNLSFAGSSVPLARVRRPASPLRHVNILGGASASGASSPTTPSSSYRSYDSISSYTSATSMTSSIPSTPTSTRSRSPSISSLETIPDSPDAEEAALEAERIAQLKAAADAADRAEGSETKGRSSLDVPSRGRTLGGFGSRDKRKRWSVCGAERRGDIDLETVWEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.28
4 0.27
5 0.26
6 0.26
7 0.3
8 0.3
9 0.3
10 0.29
11 0.26
12 0.26
13 0.24
14 0.24
15 0.19
16 0.16
17 0.15
18 0.14
19 0.14
20 0.19
21 0.19
22 0.18
23 0.22
24 0.23
25 0.31
26 0.4
27 0.47
28 0.43
29 0.48
30 0.54
31 0.55
32 0.6
33 0.57
34 0.53
35 0.49
36 0.5
37 0.45
38 0.44
39 0.4
40 0.33
41 0.3
42 0.27
43 0.22
44 0.23
45 0.29
46 0.27
47 0.3
48 0.34
49 0.36
50 0.39
51 0.41
52 0.4
53 0.39
54 0.42
55 0.44
56 0.43
57 0.46
58 0.43
59 0.42
60 0.46
61 0.46
62 0.45
63 0.42
64 0.39
65 0.33
66 0.34
67 0.36
68 0.33
69 0.28
70 0.25
71 0.24
72 0.27
73 0.26
74 0.27
75 0.23
76 0.2
77 0.21
78 0.21
79 0.19
80 0.16
81 0.17
82 0.2
83 0.21
84 0.22
85 0.19
86 0.18
87 0.17
88 0.17
89 0.14
90 0.08
91 0.07
92 0.06
93 0.07
94 0.07
95 0.08
96 0.09
97 0.09
98 0.11
99 0.15
100 0.2
101 0.24
102 0.31
103 0.38
104 0.42
105 0.46
106 0.51
107 0.56
108 0.62
109 0.62
110 0.57
111 0.59
112 0.64
113 0.69
114 0.68
115 0.67
116 0.6
117 0.57
118 0.58
119 0.5
120 0.44
121 0.4
122 0.38
123 0.33
124 0.33
125 0.31
126 0.27
127 0.26
128 0.21
129 0.19
130 0.16
131 0.15
132 0.19
133 0.24
134 0.29
135 0.32
136 0.32
137 0.32
138 0.35
139 0.36
140 0.29
141 0.29
142 0.3
143 0.32
144 0.34
145 0.34
146 0.29
147 0.28
148 0.28
149 0.23
150 0.16
151 0.11
152 0.09
153 0.08
154 0.08
155 0.07
156 0.08
157 0.1
158 0.12
159 0.13
160 0.18
161 0.2
162 0.23
163 0.26
164 0.32
165 0.35
166 0.43
167 0.47
168 0.43
169 0.44
170 0.41
171 0.37
172 0.31
173 0.26
174 0.17
175 0.11
176 0.09
177 0.05
178 0.05
179 0.05
180 0.03
181 0.03
182 0.04
183 0.04
184 0.05
185 0.06
186 0.07
187 0.08
188 0.1
189 0.15
190 0.18
191 0.19
192 0.21
193 0.22
194 0.22
195 0.22
196 0.23
197 0.19
198 0.18
199 0.17
200 0.15
201 0.13
202 0.12
203 0.11
204 0.08
205 0.08
206 0.07
207 0.07
208 0.08
209 0.08
210 0.09
211 0.1
212 0.11
213 0.14
214 0.14
215 0.19
216 0.23
217 0.26
218 0.3
219 0.34
220 0.38
221 0.38
222 0.4
223 0.4
224 0.4
225 0.39
226 0.36
227 0.32
228 0.29
229 0.27
230 0.23
231 0.19
232 0.15
233 0.13
234 0.12
235 0.11
236 0.1
237 0.09
238 0.08
239 0.07
240 0.07
241 0.06
242 0.06
243 0.05
244 0.05
245 0.06
246 0.07
247 0.07
248 0.06
249 0.07
250 0.08
251 0.09
252 0.09
253 0.08
254 0.08
255 0.09
256 0.09
257 0.1
258 0.09
259 0.09
260 0.1
261 0.1
262 0.14
263 0.19
264 0.19
265 0.19
266 0.22
267 0.22
268 0.22
269 0.23
270 0.28
271 0.3
272 0.38
273 0.39
274 0.41
275 0.43
276 0.41
277 0.4
278 0.31
279 0.27
280 0.25
281 0.27
282 0.26
283 0.29
284 0.38
285 0.46
286 0.52
287 0.53
288 0.55
289 0.61
290 0.66
291 0.69
292 0.71
293 0.72
294 0.77
295 0.83
296 0.81
297 0.76
298 0.7
299 0.64
300 0.55
301 0.45
302 0.35
303 0.27
304 0.21